Moléculas biológicas<br />Proteínas<br />Ácidosnucleicos<br />Carbohidratos<br />Lípidos<br />Coenzimas<br />Hormonas<br /...
Funciones de lasmacromoléculas<br />Enzimas<br />Reconocimientomolecular<br />Proteínasde soporte<br />Informacióngenética...
Proteínas<br />Su estructura química está formada por la unión en cadena lineal de un conjunto de bloques. <br />Cada bloq...
Aminoácidos<br />Son los “ladrillos” de las proteínas. Todos tienen la misma estructura básica. <br />
Lehninger , 3rd edition<br />
Propiedades de los aminoácidos<br />*Existen 20 tipos (de manera general).<br />*Las propiedades de cada aminoácido están ...
Residuos hidrofóbicos<br />
Residuos hidrofílicos no-cargados<br />
Residuos hidrofílicos cargados<br />
Residuos anfipáticos<br />
Residuos conformacionalmente importantes<br />
8,926,016 entries<br />
Propiedades de aa<br />
R<br />ácido<br />amino<br />NH2<br />Ca<br />COOH<br />H<br />NH2<br />COO-<br />COOH<br />NH3+<br />pKa ~ 2.2<br />pKa ~...
pKa<br />El pH se define como la concentración de iones hidronio.<br />…esto se basa en el equilibrio que se logra entre u...
La constante de equilibrio de esta reacción esta dada por:<br />Si despejamos [H+]<br />
Aplicando log en ambos lados de la ecuación (..y un signo negativo).<br />Esta es la ecuación de Henderson-Hasselbach<br />
Quesignifica la ecuación de Henderson-Hasselbalch<br />	      pH  =  pK + log ([A-]/[HA])<br />Si consideramosque un ácido...
Titulación de la alanina con NaOH<br />http://www.wiley.com/college/fob/quiz/quiz04/4-8.html<br />
Titulación de la histidina con NaOH<br />
Histidina<br />Debido a que el pKa de la histidina es cercano a un pH neutro, su estado de protonación depende fuertemente...
Enlace Peptidico<br />Para generar una proteína, los aminoácidos se unen en una cadena polipeptidica a través de un enlace...
Polipéptidos<br />Las proteínas no son mas que larguísimas cadenas polipéptidicas.<br />Las cadenas que tienen menos de 50...
8,926,016 entries<br />204aa=160,000<br />206aa=64,000,000<br />208aa=2.56 x 1010<br />2077aa=7.5 x 1098<br />
Ángulos y Enlaces<br />
Angulos dihedrales<br />
Grafica de Ramachandran<br />Los ángulos φ y ψ presentes en los aminoácidos que conforman una cadena polipeptidica o una p...
Estructura Secundaria<br />La estructura primaria, o mejor dicho, la cadena principal de una proteína debe organizarse en ...
Puentes Disulfuro<br />Pares de cisteínas son capaces de formar enlaces covalentes entre ellos (cistinas).<br />Esto adici...
Estructura Terciaria<br /><ul><li>Para lograr que una proteína parezca una proteína, los elementos de estructura secundari...
Frecuentemente, estos agrupamientos de estructuras secundarias dan lugar a agrupamientos llamados motifs (greek key, EF ha...
Muchas enzimas necesitan encontrase en estado multimerico para poder realizar su función biologica.</li></li></ul><li>Enla...
Sin embargo los enlaces no-covalentes son muy usados en la estabilización de estructuras secundarias, terciarias y cuatern...
Estos enlaces incluyen: Puentes de hidrogeno, puentes salinos, interacciones de van derwaals, etc</li></li></ul><li>Enlace...
Su energía de enlace esta entre 2 y 5 kcal/mol y su distancia ideal de enlace es de entre 2.8 y 3 Å.</li></li></ul><li>
Puentes Salinos<br /><ul><li>Son uniones electrostáticas entre grupos con carga opuesta.
Su energía de enlace esta entre 4 y 7 kcal/mol.</li></li></ul><li>Interacciones de van der Waals<br /><ul><li>Las interacc...
Los átomos con dipolos (o multipolos) inducen e interactúan con dipolos en otros átomos (siguiendo el principio de dispers...
Interacciones hidrofóbicas<br /><ul><li>Las interacciones hidrofóbicas no son interacciones de atracción, resultan de la i...
Excepciones a la cadena lineal<br />El enlace de disulfuro<br />
Estrategias de investigación en bioquímica<br />Estudio de unafunción<br />Detección de la funciónelegida (ensayo).<br />B...
OBTENCIÓN DE MATERIAL<br />Proteínas extracelulares <br />Lisis enzimática (protoplastos)<br />Sonicación<br />Prensa de F...
Fraccionamientosubcelularporcentrifugaciónsecuencial<br />
Fraccionamiento en gradientes de sacarosa/percoll<br />
<ul><li>Cada técnica ofrece un balance entre resolución, velocidad, capacidad y recuperación y deben ser seleccionadas en ...
En general, la optimización de cualquiera de estos parámetros puede obtenerse solamente a costas de los otros de forma que...
La importancia de cada parámetro variará dependiendo si el paso de purificación esta dirigido a capturar, si es intermedio...
SOLUBILIDAD<br />
Fraccionamiento por salting-out<br />
Tamaño molecular, Dialisis<br />Page 139<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
CARGA<br />
Cromatografía de intercambioiónico<br />
Generación de un gradiente lineal de concentración<br />Conc.salina<br />Vol. Eluente<br />
Separación de proteinas con diferentepI<br />rCssII-CO2H,  nCssII-CONH2 y 6HisrCssII-CO2H<br />rCssIIE15R-CO2H y 6HisrCssI...
Separación de proteinas con diferente pI<br />rCssII-CO2H,  nCssII-CONH2 y 6HisrCssII-CO2H<br />rCssIIE15R-CO2H y 6HisrCss...
VOLÚMEN HIDRODINÁMICO<br />
Cromatografía de permeaciónen gel<br />
Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
Masa molecular de varias proteínas<br />Page 138<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
HIDROFOBICIDAD<br />
Cromatografía de interacción hidrofóbica<br />
Fasereversa- elución con solvente no-polar<br />elución con solvente polar<br />Voet Biochemistry 3e<br />© 2004 John Wile...
ESPECIFICIDAD<br />
Cromatografia de afinidad<br />Page 139<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
INSTRUMENTACIÓN<br />
High Performance Liquid Chromatography System<br />
Equipos de purificación <br />
REPORTE DE UNA PURIFICACIÓN<br />
Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
ANÁLISIS<br />
Electroforésis en líquido y en papel<br />
Electroforésisen gel<br />Page 147<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
Page 146<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />Electroforesis en gel<br />
Electroforesis en gel de poliacrilamida (PAGE)<br />
SDS-PAGE<br />[CH3-(CH2)10-CH2-O-SO3 ]Na+<br />DOCECIL SULFATO DE SODIO<br />(SDS)<br />
Formula general de ampholytesparaseparaciónporpuntoisoeléctrico<br />Isoelectric focusing<br />Page 150<br />Voet Biochemi...
Page 150<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />Two-dimensional (2D) gel electrophoresis<br />
Immunoblot<br />Page 148<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
Determinación de proteína<br />1) UV absorbancia(Coeficientesde extinción)<br />2) Colorimétricos (Biuret, BCA, Bradford)<...
Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />Espectro de absorbancia UV de aminoácidosaromáticos<br />
BIURET o de LOWRY.<br />Complejo coloreado de cobre con el enlace peptídico<br />
BRADFORD<br />Se basa en la unión de un colorante, Comassie Blue G-250<br />Las lecturas se realizan a longitudes de onda ...
BCA<br />El ácido bicinconínico, sal sódica, es un compuesto capaz<br />de formar un complejo púrpura intenso con iones Cu...
Enzyme-Linked ImmunoSorbentAssay (ELISA)http://www.wiley.com/college/fob/quiz/quiz05/5-3.html<br />Page 130<br />Voet Bioc...
Próxima SlideShare
Cargando en…5
×

Clase Aminoácidos y purificación proteínas

3.752 visualizaciones

Publicado el

0 comentarios
3 recomendaciones
Estadísticas
Notas
  • Sé el primero en comentar

Sin descargas
Visualizaciones
Visualizaciones totales
3.752
En SlideShare
0
De insertados
0
Número de insertados
4
Acciones
Compartido
0
Descargas
0
Comentarios
0
Recomendaciones
3
Insertados 0
No insertados

No hay notas en la diapositiva.

Clase Aminoácidos y purificación proteínas

  1. 1. Moléculas biológicas<br />Proteínas<br />Ácidosnucleicos<br />Carbohidratos<br />Lípidos<br />Coenzimas<br />Hormonas<br />Polímeros<br />Membranas<br />
  2. 2. Funciones de lasmacromoléculas<br />Enzimas<br />Reconocimientomolecular<br />Proteínasde soporte<br />Informacióngenética<br />Acumularenergía<br />Separarcompartimentos<br />Proteínas..............<br />Ácidosnucleicos..<br />Carbohidratos.....<br />Lípidos.................<br />
  3. 3. Proteínas<br />Su estructura química está formada por la unión en cadena lineal de un conjunto de bloques. <br />Cada bloque es uno de los 20 aminoácidos que se listan.<br />
  4. 4. Aminoácidos<br />Son los “ladrillos” de las proteínas. Todos tienen la misma estructura básica. <br />
  5. 5. Lehninger , 3rd edition<br />
  6. 6.
  7. 7.
  8. 8.
  9. 9.
  10. 10. Propiedades de los aminoácidos<br />*Existen 20 tipos (de manera general).<br />*Las propiedades de cada aminoácido están determinadas por su cadena lateral.<br />*Existen abreviaciones con códigos de una y tres letras (!).<br />
  11. 11. Residuos hidrofóbicos<br />
  12. 12. Residuos hidrofílicos no-cargados<br />
  13. 13. Residuos hidrofílicos cargados<br />
  14. 14. Residuos anfipáticos<br />
  15. 15. Residuos conformacionalmente importantes<br />
  16. 16.
  17. 17. 8,926,016 entries<br />
  18. 18. Propiedades de aa<br />
  19. 19. R<br />ácido<br />amino<br />NH2<br />Ca<br />COOH<br />H<br />NH2<br />COO-<br />COOH<br />NH3+<br />pKa ~ 2.2<br />pKa ~ 9.4<br />R<br />+NH3<br />Ca<br />COO-<br />H<br />A pH fisiológico los aminoácidos son zwitteriones<br />Aminoácidos<br />Los grupos amino y ácido carboxílico tienen pKa’s<br />
  20. 20. pKa<br />El pH se define como la concentración de iones hidronio.<br />…esto se basa en el equilibrio que se logra entre una molécula y sus ácidos y bases conjugados.<br />
  21. 21. La constante de equilibrio de esta reacción esta dada por:<br />Si despejamos [H+]<br />
  22. 22. Aplicando log en ambos lados de la ecuación (..y un signo negativo).<br />Esta es la ecuación de Henderson-Hasselbach<br />
  23. 23. Quesignifica la ecuación de Henderson-Hasselbalch<br /> pH = pK + log ([A-]/[HA])<br />Si consideramosque un ácido HA esta 50% disociado<br />HA H+ + A- i.e. [HA] = [A-]<br />En laecuaciónel términolog ([A-]/[HA]) eslog 1 y log 1 = 0<br />Lo cual se traduce a pH = pK<br />Luegoentonces:<br />El pKesunamedida del pH al cual un grupo<br />Ionizableestadisociado en un 50%<br />
  24. 24. Titulación de la alanina con NaOH<br />http://www.wiley.com/college/fob/quiz/quiz04/4-8.html<br />
  25. 25. Titulación de la histidina con NaOH<br />
  26. 26.
  27. 27. Histidina<br />Debido a que el pKa de la histidina es cercano a un pH neutro, su estado de protonación depende fuertemente de su ambiente local. Esta característica es empleada frecuentemente en la naturaleza para usarlo como un interruptor molecular.<br />
  28. 28. Enlace Peptidico<br />Para generar una proteína, los aminoácidos se unen en una cadena polipeptidica a través de un enlace peptidico.<br />
  29. 29.
  30. 30. Polipéptidos<br />Las proteínas no son mas que larguísimas cadenas polipéptidicas.<br />Las cadenas que tienen menos de 50 (en ocasiones el limite se fija en 100!) aminoácidos o residuos son llamada polipéptidos.<br />Si las cadenas son mas grandes…se les llama proteínas.<br />
  31. 31. 8,926,016 entries<br />204aa=160,000<br />206aa=64,000,000<br />208aa=2.56 x 1010<br />2077aa=7.5 x 1098<br />
  32. 32.
  33. 33. Ángulos y Enlaces<br />
  34. 34. Angulos dihedrales<br />
  35. 35.
  36. 36.
  37. 37. Grafica de Ramachandran<br />Los ángulos φ y ψ presentes en los aminoácidos que conforman una cadena polipeptidica o una proteína se encuentran restringidos. Esto se debe mayoritariamente a impedimentos estéricos (excepto la glicina!)<br />
  38. 38.
  39. 39. Estructura Secundaria<br />La estructura primaria, o mejor dicho, la cadena principal de una proteína debe organizarse en una manera compacta. Esto se hace produciendo elementos de estructura secundaria.<br />Los dos elementos mas comunes son las hélices alfa y las hojas beta, formadas por aminoácidos con ángulos φ y ψ mas o menos similares.<br />Existen mas elementos de estructura secundaria como son: turns, coils, hélices 3 10, etc.<br />
  40. 40.
  41. 41.
  42. 42.
  43. 43.
  44. 44. Puentes Disulfuro<br />Pares de cisteínas son capaces de formar enlaces covalentes entre ellos (cistinas).<br />Esto adiciona estabilidad y es común e proteínas extracelulares.<br />
  45. 45. Estructura Terciaria<br /><ul><li>Para lograr que una proteína parezca una proteína, los elementos de estructura secundaria se agrupan formando elementos de estructura terciaria.
  46. 46. Frecuentemente, estos agrupamientos de estructuras secundarias dan lugar a agrupamientos llamados motifs (greek key, EF hand, beta hairpin, etc).</li></li></ul><li>Estructura Cuaternaria<br /><ul><li>Las proteinas plegadas pueden reagruparse formando oligomeros.
  47. 47. Muchas enzimas necesitan encontrase en estado multimerico para poder realizar su función biologica.</li></li></ul><li>Enlaces No-Covalentes<br /><ul><li>Los enlaces que forman al polipéptido, así como los puentes disulfuro, son enlaces covalentes.
  48. 48. Sin embargo los enlaces no-covalentes son muy usados en la estabilización de estructuras secundarias, terciarias y cuaternarias.
  49. 49. Estos enlaces incluyen: Puentes de hidrogeno, puentes salinos, interacciones de van derwaals, etc</li></li></ul><li>Enlaces de Hidrógeno<br /><ul><li>Se forman al compartir un protón entre un donador y un aceptor.
  50. 50. Su energía de enlace esta entre 2 y 5 kcal/mol y su distancia ideal de enlace es de entre 2.8 y 3 Å.</li></li></ul><li>
  51. 51. Puentes Salinos<br /><ul><li>Son uniones electrostáticas entre grupos con carga opuesta.
  52. 52. Su energía de enlace esta entre 4 y 7 kcal/mol.</li></li></ul><li>Interacciones de van der Waals<br /><ul><li>Las interacciones electrostáticas no explican a todas las interacciones no-covalentes entre moléculas (especialmente en especias con carga parcial, o bien, no cargadas).
  53. 53. Los átomos con dipolos (o multipolos) inducen e interactúan con dipolos en otros átomos (siguiendo el principio de dispersión de fuerzas 1/r6)</li></li></ul><li>Lennard-Jones<br />
  54. 54. Interacciones hidrofóbicas<br /><ul><li>Las interacciones hidrofóbicas no son interacciones de atracción, resultan de la imposibilidad del agua para formar enlaces de hidrogeno con ciertas cadenas laterales.</li></li></ul><li>
  55. 55.
  56. 56.
  57. 57. Excepciones a la cadena lineal<br />El enlace de disulfuro<br />
  58. 58.
  59. 59. Estrategias de investigación en bioquímica<br />Estudio de unafunción<br />Detección de la funciónelegida (ensayo).<br />Búsqueda de unamolécularesponsable de la función (en general de unaproteína????).<br />Selección de unafuente (organismo y/o tejidoidóneo).<br /><ul><li>Caracterización de proteínaspuras.</li></li></ul><li>Purificaciónde proteínas<br />
  60. 60. OBTENCIÓN DE MATERIAL<br />Proteínas extracelulares <br />Lisis enzimática (protoplastos)<br />Sonicación<br />Prensa de French<br />Extracción<br />Congelado y descongelado<br />ETC…<br />
  61. 61. Fraccionamientosubcelularporcentrifugaciónsecuencial<br />
  62. 62. Fraccionamiento en gradientes de sacarosa/percoll<br />
  63. 63.
  64. 64.
  65. 65. <ul><li>Cada técnica ofrece un balance entre resolución, velocidad, capacidad y recuperación y deben ser seleccionadas en función de los objetivos de cada paso de la purificación.
  66. 66. En general, la optimización de cualquiera de estos parámetros puede obtenerse solamente a costas de los otros de forma que cada paso de la purificación debe ser seriamente evaluado.
  67. 67. La importancia de cada parámetro variará dependiendo si el paso de purificación esta dirigido a capturar, si es intermedio o si es de refinado. </li></li></ul><li>
  68. 68. SOLUBILIDAD<br />
  69. 69. Fraccionamiento por salting-out<br />
  70. 70. Tamaño molecular, Dialisis<br />Page 139<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  71. 71. CARGA<br />
  72. 72. Cromatografía de intercambioiónico<br />
  73. 73. Generación de un gradiente lineal de concentración<br />Conc.salina<br />Vol. Eluente<br />
  74. 74. Separación de proteinas con diferentepI<br />rCssII-CO2H, nCssII-CONH2 y 6HisrCssII-CO2H<br />rCssIIE15R-CO2H y 6HisrCssII-CO2H<br />nCssII<br /> KEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CONH2<br />Theoretical pI/Mw: 8.15 / 7546.61<br />HisrCssII<br />MRGSHHHHHHGSIEGRKEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CO2H<br />Theoretical pI/Mw: 8.43 / 9400.62<br />rCssII<br /> KEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CO2H<br />Theoretical pI/Mw: 8.15 / 7546.61<br />rCssIIE15R<br /> KEGYLVSKSTGCKYRCLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CO2H<br />Theoretical pI/Mw: 8.65 / 7573.69<br />HisrCssIIIE15R<br />MRGSHHHHHHGSIEGRKEGYLVSKSTGCKYRCLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CO2H<br />Theoretical pI/Mw: 8.82 / 9427.69<br />
  75. 75. Separación de proteinas con diferente pI<br />rCssII-CO2H, nCssII-CONH2 y 6HisrCssII-CO2H<br />rCssIIE15R-CO2H y 6HisrCssII-CO2H©<br />
  76. 76. VOLÚMEN HIDRODINÁMICO<br />
  77. 77. Cromatografía de permeaciónen gel<br />
  78. 78. Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  79. 79. Masa molecular de varias proteínas<br />Page 138<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  80. 80. HIDROFOBICIDAD<br />
  81. 81. Cromatografía de interacción hidrofóbica<br />
  82. 82. Fasereversa- elución con solvente no-polar<br />elución con solvente polar<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  83. 83. ESPECIFICIDAD<br />
  84. 84. Cromatografia de afinidad<br />Page 139<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  85. 85. INSTRUMENTACIÓN<br />
  86. 86. High Performance Liquid Chromatography System<br />
  87. 87. Equipos de purificación <br />
  88. 88. REPORTE DE UNA PURIFICACIÓN<br />
  89. 89. Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  90. 90. ANÁLISIS<br />
  91. 91. Electroforésis en líquido y en papel<br />
  92. 92. Electroforésisen gel<br />Page 147<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  93. 93. Page 146<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />Electroforesis en gel<br />
  94. 94. Electroforesis en gel de poliacrilamida (PAGE)<br />
  95. 95. SDS-PAGE<br />[CH3-(CH2)10-CH2-O-SO3 ]Na+<br />DOCECIL SULFATO DE SODIO<br />(SDS)<br />
  96. 96.
  97. 97. Formula general de ampholytesparaseparaciónporpuntoisoeléctrico<br />Isoelectric focusing<br />Page 150<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  98. 98. Page 150<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />Two-dimensional (2D) gel electrophoresis<br />
  99. 99.
  100. 100. Immunoblot<br />Page 148<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  101. 101. Determinación de proteína<br />1) UV absorbancia(Coeficientesde extinción)<br />2) Colorimétricos (Biuret, BCA, Bradford)<br />3) Enzimáticos (ELISA-proteínasespecíficas)<br />4) Otros<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  102. 102. Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />Espectro de absorbancia UV de aminoácidosaromáticos<br />
  103. 103. BIURET o de LOWRY.<br />Complejo coloreado de cobre con el enlace peptídico<br />
  104. 104. BRADFORD<br />Se basa en la unión de un colorante, Comassie Blue G-250<br />Las lecturas se realizan a longitudes de onda 400-560 nm<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />
  105. 105. BCA<br />El ácido bicinconínico, sal sódica, es un compuesto capaz<br />de formar un complejo púrpura intenso con iones Cu 1+<br />en medio alcalino.<br />
  106. 106. Enzyme-Linked ImmunoSorbentAssay (ELISA)http://www.wiley.com/college/fob/quiz/quiz05/5-3.html<br />Page 130<br />Voet Biochemistry 3e<br />© 2004 John Wiley & Sons, Inc.<br />

×