SlideShare una empresa de Scribd logo
1 de 14
SoberIT
Software Business and Engineering Institute
Requirements
Change Management
SoberIT
Software Business and Engineering Institute
Agenda
• Introduction
• Requirements Change Management Process
• Traceability
• Summary
SoberIT
Software Business and Engineering Institute
Introduction (1/3)
requirements
definition
specification &
design &
coding &
testing
acceptance
testing
requirements management
Requirements management is the process of managing changes to a
system’s requirements [Kot98], and it is an important part of
requirements engineering.
SoberIT
Software Business and Engineering Institute
Introduction (2/3)
• It is often the case that more than 50% of a system’s
requirements will be modified before it is put into service [Kot98].
• New requirements emerge and existing change due to
• errors
• increased understanding
• change in external circumstances.
SoberIT
Software Business and Engineering Institute
Introduction (3/3)
Changes to the requirements should be
documented and controlled formally.
Change management process ensures that
• changes are made systematically
•similar information is collected for each proposed change
•overall analysis is made about the costs, benefits and
timing
• the requirements document is updated.
SoberIT
Software Business and Engineering Institute
Requirements Change Management
Process (1/5)
requirements
change management
process
• updated user requirements document
• change history
recording analysing deciding implementing
• approved user requirements document
• change proposal
SoberIT
Software Business and Engineering Institute
Requirements Change Management
Process (2/5)
Recording a change proposal:
• Stakeholders submit proposals for requirements changes using a
pre-defined form.
SoberIT
Software Business and Engineering Institute
Requirements Change Management
Process (3/5)
Analysing a change request:
• The proposed change is analysed to see
• if it is valid. Sometimes stakeholders misunderstand the
requirements and suggest unnecessary changes.
• how many requirements and system components are affected
• how much it would cost, in both time and money, to make
the change
• what the benefits of the change are.
SoberIT
Software Business and Engineering Institute
Requirements Change Management
Process (4/5)
Deciding on a change request:
• Change requests are considered formally by a group or a person
who decide whether or not the change should be accepted.
SoberIT
Software Business and Engineering Institute
Requirements Change Management
Process (5/5)
Implementing a change:
• Updating the requirements document.
• Informing all the necessary people.
SoberIT
Software Business and Engineering Institute
Traceability
• Requirements cannot be managed effectively without
requirements traceability [Kot98].
• Traceability types [Som97]
• requirements - sources
• requirements - rationale
• requirements - requirements
• requirements - architecture
• requirements - test cases
SoberIT
Software Business and Engineering Institute
Summary (1/2)
User
requirements
definition
User requirements management
Design, coding and
system testing
Acceptance
testing
Requirements Engineering
Useful and Successful Products
SoberIT
Software Business and Engineering Institute
Summary (2/2)
Systematic requirements change management ensures that
product development produces useful and succesful
systems.
SoberIT
Software Business and Engineering Institute
References
• [Kot98] G. Kotonya and I. Sommerville, Requirements Engineering -
Processes and Techniques, John Wiley & Sons, New York, 1998.
• [Som97] I. Sommerville and P. Sawyer, Requirements Engineering -
A Good Practice Guide, John Wiley & Sons, New York, 1997.

Más contenido relacionado

La actualidad más candente

Software Process Models
Software Process ModelsSoftware Process Models
Software Process ModelsAtul Karmyal
 
Web Engineering - Web Applications versus Conventional Software
Web Engineering - Web Applications versus Conventional SoftwareWeb Engineering - Web Applications versus Conventional Software
Web Engineering - Web Applications versus Conventional SoftwareNosheen Qamar
 
Software development life cycle (SDLC)
Software development life cycle (SDLC)Software development life cycle (SDLC)
Software development life cycle (SDLC)Simran Kaur
 
Software Engineering- Requirement Elicitation and Specification
Software Engineering- Requirement Elicitation and SpecificationSoftware Engineering- Requirement Elicitation and Specification
Software Engineering- Requirement Elicitation and SpecificationNishu Rastogi
 
Software engineering project management
Software engineering project managementSoftware engineering project management
Software engineering project managementjhudyne
 
PRESCRIPTIVE PROCESS MODEL(SOFTWARE ENGINEERING)
PRESCRIPTIVE PROCESS MODEL(SOFTWARE ENGINEERING)PRESCRIPTIVE PROCESS MODEL(SOFTWARE ENGINEERING)
PRESCRIPTIVE PROCESS MODEL(SOFTWARE ENGINEERING)IrtazaAfzal3
 
Software project planning
Software project planningSoftware project planning
Software project planningrajvir_kaur
 
Risk management(software engineering)
Risk management(software engineering)Risk management(software engineering)
Risk management(software engineering)Priya Tomar
 
Object oriented analysis &design - requirement analysis
Object oriented analysis &design - requirement analysisObject oriented analysis &design - requirement analysis
Object oriented analysis &design - requirement analysisAbhilasha Lahigude
 
Requirements prioritization
Requirements prioritizationRequirements prioritization
Requirements prioritizationSyed Zaid Irshad
 
SRS(software requirement specification)
SRS(software requirement specification)SRS(software requirement specification)
SRS(software requirement specification)Akash Kumar Dhameja
 
Project Planning in Software Engineering
Project Planning in Software EngineeringProject Planning in Software Engineering
Project Planning in Software EngineeringFáber D. Giraldo
 
Software project management
Software project managementSoftware project management
Software project managementR A Akerkar
 
Introduction to Software Project Management
Introduction to Software Project ManagementIntroduction to Software Project Management
Introduction to Software Project ManagementReetesh Gupta
 

La actualidad más candente (20)

Software Process Models
Software Process ModelsSoftware Process Models
Software Process Models
 
Domain Modeling
Domain ModelingDomain Modeling
Domain Modeling
 
Web Engineering - Web Applications versus Conventional Software
Web Engineering - Web Applications versus Conventional SoftwareWeb Engineering - Web Applications versus Conventional Software
Web Engineering - Web Applications versus Conventional Software
 
Software development life cycle (SDLC)
Software development life cycle (SDLC)Software development life cycle (SDLC)
Software development life cycle (SDLC)
 
Software Engineering- Requirement Elicitation and Specification
Software Engineering- Requirement Elicitation and SpecificationSoftware Engineering- Requirement Elicitation and Specification
Software Engineering- Requirement Elicitation and Specification
 
Software quality
Software qualitySoftware quality
Software quality
 
Software engineering project management
Software engineering project managementSoftware engineering project management
Software engineering project management
 
Functional modeling
Functional modelingFunctional modeling
Functional modeling
 
PRESCRIPTIVE PROCESS MODEL(SOFTWARE ENGINEERING)
PRESCRIPTIVE PROCESS MODEL(SOFTWARE ENGINEERING)PRESCRIPTIVE PROCESS MODEL(SOFTWARE ENGINEERING)
PRESCRIPTIVE PROCESS MODEL(SOFTWARE ENGINEERING)
 
Software project planning
Software project planningSoftware project planning
Software project planning
 
Risk management(software engineering)
Risk management(software engineering)Risk management(software engineering)
Risk management(software engineering)
 
Object oriented analysis &design - requirement analysis
Object oriented analysis &design - requirement analysisObject oriented analysis &design - requirement analysis
Object oriented analysis &design - requirement analysis
 
Requirements prioritization
Requirements prioritizationRequirements prioritization
Requirements prioritization
 
Database recovery
Database recoveryDatabase recovery
Database recovery
 
Spm unit 4
Spm unit 4Spm unit 4
Spm unit 4
 
SRS(software requirement specification)
SRS(software requirement specification)SRS(software requirement specification)
SRS(software requirement specification)
 
Staffing level estimation
Staffing level estimation Staffing level estimation
Staffing level estimation
 
Project Planning in Software Engineering
Project Planning in Software EngineeringProject Planning in Software Engineering
Project Planning in Software Engineering
 
Software project management
Software project managementSoftware project management
Software project management
 
Introduction to Software Project Management
Introduction to Software Project ManagementIntroduction to Software Project Management
Introduction to Software Project Management
 

Similar a Requirement change management

Requirement management traceability.ppt
Requirement management  traceability.pptRequirement management  traceability.ppt
Requirement management traceability.pptubaidullah75790
 
Requirments management traceability.ppt
Requirments  management traceability.pptRequirments  management traceability.ppt
Requirments management traceability.pptubaidullah75790
 
340_18CS35_se_mod1(secab).pdf
340_18CS35_se_mod1(secab).pdf340_18CS35_se_mod1(secab).pdf
340_18CS35_se_mod1(secab).pdfkrishnaraj714229
 
SUMSEM-2021-22_ITE2015_TH_VL2021220701427_Reference_Material_I_20-07-2022_2.3...
SUMSEM-2021-22_ITE2015_TH_VL2021220701427_Reference_Material_I_20-07-2022_2.3...SUMSEM-2021-22_ITE2015_TH_VL2021220701427_Reference_Material_I_20-07-2022_2.3...
SUMSEM-2021-22_ITE2015_TH_VL2021220701427_Reference_Material_I_20-07-2022_2.3...HarshMangal20
 
Software Configuration Management.pptx
Software Configuration Management.pptxSoftware Configuration Management.pptx
Software Configuration Management.pptxMaSheilaMagboo
 
Student-CSV-Presentation.pptx
Student-CSV-Presentation.pptxStudent-CSV-Presentation.pptx
Student-CSV-Presentation.pptxmugimbasmith2
 
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.pptsfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.pptssuser2d043c
 
SE_Unit 3_System & Requirement Engineering.pdf
SE_Unit 3_System & Requirement Engineering.pdfSE_Unit 3_System & Requirement Engineering.pdf
SE_Unit 3_System & Requirement Engineering.pdfRAVALCHIRAG1
 
Software maintenance and configuration management, software engineering
Software maintenance and  configuration management, software engineeringSoftware maintenance and  configuration management, software engineering
Software maintenance and configuration management, software engineeringRupesh Vaishnav
 
Change Management
Change ManagementChange Management
Change Managementramikanso
 
ITIL Best Practice for Software Companies
ITIL Best Practice for Software CompaniesITIL Best Practice for Software Companies
ITIL Best Practice for Software CompaniesDaniel Brody
 

Similar a Requirement change management (20)

Requirement management traceability.ppt
Requirement management  traceability.pptRequirement management  traceability.ppt
Requirement management traceability.ppt
 
Requirments management traceability.ppt
Requirments  management traceability.pptRequirments  management traceability.ppt
Requirments management traceability.ppt
 
340_18CS35_se_mod1(secab).pdf
340_18CS35_se_mod1(secab).pdf340_18CS35_se_mod1(secab).pdf
340_18CS35_se_mod1(secab).pdf
 
Requirements management
Requirements managementRequirements management
Requirements management
 
SUMSEM-2021-22_ITE2015_TH_VL2021220701427_Reference_Material_I_20-07-2022_2.3...
SUMSEM-2021-22_ITE2015_TH_VL2021220701427_Reference_Material_I_20-07-2022_2.3...SUMSEM-2021-22_ITE2015_TH_VL2021220701427_Reference_Material_I_20-07-2022_2.3...
SUMSEM-2021-22_ITE2015_TH_VL2021220701427_Reference_Material_I_20-07-2022_2.3...
 
Software Configuration Management.pptx
Software Configuration Management.pptxSoftware Configuration Management.pptx
Software Configuration Management.pptx
 
Scm
ScmScm
Scm
 
Student-CSV-Presentation.pptx
Student-CSV-Presentation.pptxStudent-CSV-Presentation.pptx
Student-CSV-Presentation.pptx
 
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.pptsfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
 
SE_Unit 3_System & Requirement Engineering.pdf
SE_Unit 3_System & Requirement Engineering.pdfSE_Unit 3_System & Requirement Engineering.pdf
SE_Unit 3_System & Requirement Engineering.pdf
 
Software maintenance and configuration management, software engineering
Software maintenance and  configuration management, software engineeringSoftware maintenance and  configuration management, software engineering
Software maintenance and configuration management, software engineering
 
تحليل النظم
تحليل النظمتحليل النظم
تحليل النظم
 
Software Requirements engineering
Software Requirements engineeringSoftware Requirements engineering
Software Requirements engineering
 
Change Management
Change ManagementChange Management
Change Management
 
Sdlc phases
Sdlc phasesSdlc phases
Sdlc phases
 
Sdlc phases
Sdlc phasesSdlc phases
Sdlc phases
 
Software maintenance
Software maintenanceSoftware maintenance
Software maintenance
 
Software maintenance
Software maintenanceSoftware maintenance
Software maintenance
 
ITIL # Lecture 3
ITIL # Lecture 3ITIL # Lecture 3
ITIL # Lecture 3
 
ITIL Best Practice for Software Companies
ITIL Best Practice for Software CompaniesITIL Best Practice for Software Companies
ITIL Best Practice for Software Companies
 

Más de Abdul Basit

Atlassian git cheatsheet
Atlassian git cheatsheetAtlassian git cheatsheet
Atlassian git cheatsheetAbdul Basit
 
Github git-cheat-sheet
Github git-cheat-sheetGithub git-cheat-sheet
Github git-cheat-sheetAbdul Basit
 
White box testing
White box testingWhite box testing
White box testingAbdul Basit
 
Testing the documentation
Testing the documentationTesting the documentation
Testing the documentationAbdul Basit
 
Testing software security
Testing software securityTesting software security
Testing software securityAbdul Basit
 
Testing fundamentals
Testing fundamentalsTesting fundamentals
Testing fundamentalsAbdul Basit
 
Test cases planning
Test cases planningTest cases planning
Test cases planningAbdul Basit
 
Software Testing
Software TestingSoftware Testing
Software TestingAbdul Basit
 
Software Compatibility testing
Software Compatibility testingSoftware Compatibility testing
Software Compatibility testingAbdul Basit
 
Black box testing
Black box testingBlack box testing
Black box testingAbdul Basit
 
Software Automated testing and tools
Software Automated testing and toolsSoftware Automated testing and tools
Software Automated testing and toolsAbdul Basit
 
Why test software
Why test softwareWhy test software
Why test softwareAbdul Basit
 
Git Developer Cheatsheet
Git Developer CheatsheetGit Developer Cheatsheet
Git Developer CheatsheetAbdul Basit
 
Static white box testing lecture 12
Static white box testing lecture 12Static white box testing lecture 12
Static white box testing lecture 12Abdul Basit
 
Software testing lecture 10
Software testing lecture 10Software testing lecture 10
Software testing lecture 10Abdul Basit
 
Software testing lecture 9
Software testing lecture 9Software testing lecture 9
Software testing lecture 9Abdul Basit
 
Software quality assurance lecture 1
Software quality assurance lecture 1Software quality assurance lecture 1
Software quality assurance lecture 1Abdul Basit
 
Software measurement lecture 7
Software measurement lecture 7Software measurement lecture 7
Software measurement lecture 7Abdul Basit
 

Más de Abdul Basit (20)

Atlassian git cheatsheet
Atlassian git cheatsheetAtlassian git cheatsheet
Atlassian git cheatsheet
 
Github git-cheat-sheet
Github git-cheat-sheetGithub git-cheat-sheet
Github git-cheat-sheet
 
White box testing
White box testingWhite box testing
White box testing
 
Web testing
Web testingWeb testing
Web testing
 
Testing the documentation
Testing the documentationTesting the documentation
Testing the documentation
 
Testing software security
Testing software securityTesting software security
Testing software security
 
Testing fundamentals
Testing fundamentalsTesting fundamentals
Testing fundamentals
 
Test planning
Test planningTest planning
Test planning
 
Test cases planning
Test cases planningTest cases planning
Test cases planning
 
Software Testing
Software TestingSoftware Testing
Software Testing
 
Software Compatibility testing
Software Compatibility testingSoftware Compatibility testing
Software Compatibility testing
 
Black box testing
Black box testingBlack box testing
Black box testing
 
Software Automated testing and tools
Software Automated testing and toolsSoftware Automated testing and tools
Software Automated testing and tools
 
Why test software
Why test softwareWhy test software
Why test software
 
Git Developer Cheatsheet
Git Developer CheatsheetGit Developer Cheatsheet
Git Developer Cheatsheet
 
Static white box testing lecture 12
Static white box testing lecture 12Static white box testing lecture 12
Static white box testing lecture 12
 
Software testing lecture 10
Software testing lecture 10Software testing lecture 10
Software testing lecture 10
 
Software testing lecture 9
Software testing lecture 9Software testing lecture 9
Software testing lecture 9
 
Software quality assurance lecture 1
Software quality assurance lecture 1Software quality assurance lecture 1
Software quality assurance lecture 1
 
Software measurement lecture 7
Software measurement lecture 7Software measurement lecture 7
Software measurement lecture 7
 

Último

Famous Olympic Siblings from the 21st Century
Famous Olympic Siblings from the 21st CenturyFamous Olympic Siblings from the 21st Century
Famous Olympic Siblings from the 21st Centuryrwgiffor
 
Cheap Rate Call Girls In Noida Sector 62 Metro 959961乂3876
Cheap Rate Call Girls In Noida Sector 62 Metro 959961乂3876Cheap Rate Call Girls In Noida Sector 62 Metro 959961乂3876
Cheap Rate Call Girls In Noida Sector 62 Metro 959961乂3876dlhescort
 
RSA Conference Exhibitor List 2024 - Exhibitors Data
RSA Conference Exhibitor List 2024 - Exhibitors DataRSA Conference Exhibitor List 2024 - Exhibitors Data
RSA Conference Exhibitor List 2024 - Exhibitors DataExhibitors Data
 
Call Girls In Noida 959961⊹3876 Independent Escort Service Noida
Call Girls In Noida 959961⊹3876 Independent Escort Service NoidaCall Girls In Noida 959961⊹3876 Independent Escort Service Noida
Call Girls In Noida 959961⊹3876 Independent Escort Service Noidadlhescort
 
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...amitlee9823
 
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort ServiceEluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort ServiceDamini Dixit
 
Phases of Negotiation .pptx
 Phases of Negotiation .pptx Phases of Negotiation .pptx
Phases of Negotiation .pptxnandhinijagan9867
 
PHX May 2024 Corporate Presentation Final
PHX May 2024 Corporate Presentation FinalPHX May 2024 Corporate Presentation Final
PHX May 2024 Corporate Presentation FinalPanhandleOilandGas
 
👉Chandigarh Call Girls 👉9878799926👉Just Call👉Chandigarh Call Girl In Chandiga...
👉Chandigarh Call Girls 👉9878799926👉Just Call👉Chandigarh Call Girl In Chandiga...👉Chandigarh Call Girls 👉9878799926👉Just Call👉Chandigarh Call Girl In Chandiga...
👉Chandigarh Call Girls 👉9878799926👉Just Call👉Chandigarh Call Girl In Chandiga...rajveerescorts2022
 
Organizational Transformation Lead with Culture
Organizational Transformation Lead with CultureOrganizational Transformation Lead with Culture
Organizational Transformation Lead with CultureSeta Wicaksana
 
Malegaon Call Girls Service ☎ ️82500–77686 ☎️ Enjoy 24/7 Escort Service
Malegaon Call Girls Service ☎ ️82500–77686 ☎️ Enjoy 24/7 Escort ServiceMalegaon Call Girls Service ☎ ️82500–77686 ☎️ Enjoy 24/7 Escort Service
Malegaon Call Girls Service ☎ ️82500–77686 ☎️ Enjoy 24/7 Escort ServiceDamini Dixit
 
Falcon Invoice Discounting: Empowering Your Business Growth
Falcon Invoice Discounting: Empowering Your Business GrowthFalcon Invoice Discounting: Empowering Your Business Growth
Falcon Invoice Discounting: Empowering Your Business GrowthFalcon investment
 
The Abortion pills for sale in Qatar@Doha [+27737758557] []Deira Dubai Kuwait
The Abortion pills for sale in Qatar@Doha [+27737758557] []Deira Dubai KuwaitThe Abortion pills for sale in Qatar@Doha [+27737758557] []Deira Dubai Kuwait
The Abortion pills for sale in Qatar@Doha [+27737758557] []Deira Dubai Kuwaitdaisycvs
 
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...lizamodels9
 
SEO Case Study: How I Increased SEO Traffic & Ranking by 50-60% in 6 Months
SEO Case Study: How I Increased SEO Traffic & Ranking by 50-60%  in 6 MonthsSEO Case Study: How I Increased SEO Traffic & Ranking by 50-60%  in 6 Months
SEO Case Study: How I Increased SEO Traffic & Ranking by 50-60% in 6 MonthsIndeedSEO
 
Nelamangala Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
Nelamangala Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...Nelamangala Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
Nelamangala Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...amitlee9823
 
Value Proposition canvas- Customer needs and pains
Value Proposition canvas- Customer needs and painsValue Proposition canvas- Customer needs and pains
Value Proposition canvas- Customer needs and painsP&CO
 
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service AvailableSeo
 
Dr. Admir Softic_ presentation_Green Club_ENG.pdf
Dr. Admir Softic_ presentation_Green Club_ENG.pdfDr. Admir Softic_ presentation_Green Club_ENG.pdf
Dr. Admir Softic_ presentation_Green Club_ENG.pdfAdmir Softic
 
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...daisycvs
 

Último (20)

Famous Olympic Siblings from the 21st Century
Famous Olympic Siblings from the 21st CenturyFamous Olympic Siblings from the 21st Century
Famous Olympic Siblings from the 21st Century
 
Cheap Rate Call Girls In Noida Sector 62 Metro 959961乂3876
Cheap Rate Call Girls In Noida Sector 62 Metro 959961乂3876Cheap Rate Call Girls In Noida Sector 62 Metro 959961乂3876
Cheap Rate Call Girls In Noida Sector 62 Metro 959961乂3876
 
RSA Conference Exhibitor List 2024 - Exhibitors Data
RSA Conference Exhibitor List 2024 - Exhibitors DataRSA Conference Exhibitor List 2024 - Exhibitors Data
RSA Conference Exhibitor List 2024 - Exhibitors Data
 
Call Girls In Noida 959961⊹3876 Independent Escort Service Noida
Call Girls In Noida 959961⊹3876 Independent Escort Service NoidaCall Girls In Noida 959961⊹3876 Independent Escort Service Noida
Call Girls In Noida 959961⊹3876 Independent Escort Service Noida
 
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
 
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort ServiceEluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
 
Phases of Negotiation .pptx
 Phases of Negotiation .pptx Phases of Negotiation .pptx
Phases of Negotiation .pptx
 
PHX May 2024 Corporate Presentation Final
PHX May 2024 Corporate Presentation FinalPHX May 2024 Corporate Presentation Final
PHX May 2024 Corporate Presentation Final
 
👉Chandigarh Call Girls 👉9878799926👉Just Call👉Chandigarh Call Girl In Chandiga...
👉Chandigarh Call Girls 👉9878799926👉Just Call👉Chandigarh Call Girl In Chandiga...👉Chandigarh Call Girls 👉9878799926👉Just Call👉Chandigarh Call Girl In Chandiga...
👉Chandigarh Call Girls 👉9878799926👉Just Call👉Chandigarh Call Girl In Chandiga...
 
Organizational Transformation Lead with Culture
Organizational Transformation Lead with CultureOrganizational Transformation Lead with Culture
Organizational Transformation Lead with Culture
 
Malegaon Call Girls Service ☎ ️82500–77686 ☎️ Enjoy 24/7 Escort Service
Malegaon Call Girls Service ☎ ️82500–77686 ☎️ Enjoy 24/7 Escort ServiceMalegaon Call Girls Service ☎ ️82500–77686 ☎️ Enjoy 24/7 Escort Service
Malegaon Call Girls Service ☎ ️82500–77686 ☎️ Enjoy 24/7 Escort Service
 
Falcon Invoice Discounting: Empowering Your Business Growth
Falcon Invoice Discounting: Empowering Your Business GrowthFalcon Invoice Discounting: Empowering Your Business Growth
Falcon Invoice Discounting: Empowering Your Business Growth
 
The Abortion pills for sale in Qatar@Doha [+27737758557] []Deira Dubai Kuwait
The Abortion pills for sale in Qatar@Doha [+27737758557] []Deira Dubai KuwaitThe Abortion pills for sale in Qatar@Doha [+27737758557] []Deira Dubai Kuwait
The Abortion pills for sale in Qatar@Doha [+27737758557] []Deira Dubai Kuwait
 
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
 
SEO Case Study: How I Increased SEO Traffic & Ranking by 50-60% in 6 Months
SEO Case Study: How I Increased SEO Traffic & Ranking by 50-60%  in 6 MonthsSEO Case Study: How I Increased SEO Traffic & Ranking by 50-60%  in 6 Months
SEO Case Study: How I Increased SEO Traffic & Ranking by 50-60% in 6 Months
 
Nelamangala Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
Nelamangala Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...Nelamangala Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
Nelamangala Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
 
Value Proposition canvas- Customer needs and pains
Value Proposition canvas- Customer needs and painsValue Proposition canvas- Customer needs and pains
Value Proposition canvas- Customer needs and pains
 
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
 
Dr. Admir Softic_ presentation_Green Club_ENG.pdf
Dr. Admir Softic_ presentation_Green Club_ENG.pdfDr. Admir Softic_ presentation_Green Club_ENG.pdf
Dr. Admir Softic_ presentation_Green Club_ENG.pdf
 
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
 

Requirement change management

  • 1. SoberIT Software Business and Engineering Institute Requirements Change Management
  • 2. SoberIT Software Business and Engineering Institute Agenda • Introduction • Requirements Change Management Process • Traceability • Summary
  • 3. SoberIT Software Business and Engineering Institute Introduction (1/3) requirements definition specification & design & coding & testing acceptance testing requirements management Requirements management is the process of managing changes to a system’s requirements [Kot98], and it is an important part of requirements engineering.
  • 4. SoberIT Software Business and Engineering Institute Introduction (2/3) • It is often the case that more than 50% of a system’s requirements will be modified before it is put into service [Kot98]. • New requirements emerge and existing change due to • errors • increased understanding • change in external circumstances.
  • 5. SoberIT Software Business and Engineering Institute Introduction (3/3) Changes to the requirements should be documented and controlled formally. Change management process ensures that • changes are made systematically •similar information is collected for each proposed change •overall analysis is made about the costs, benefits and timing • the requirements document is updated.
  • 6. SoberIT Software Business and Engineering Institute Requirements Change Management Process (1/5) requirements change management process • updated user requirements document • change history recording analysing deciding implementing • approved user requirements document • change proposal
  • 7. SoberIT Software Business and Engineering Institute Requirements Change Management Process (2/5) Recording a change proposal: • Stakeholders submit proposals for requirements changes using a pre-defined form.
  • 8. SoberIT Software Business and Engineering Institute Requirements Change Management Process (3/5) Analysing a change request: • The proposed change is analysed to see • if it is valid. Sometimes stakeholders misunderstand the requirements and suggest unnecessary changes. • how many requirements and system components are affected • how much it would cost, in both time and money, to make the change • what the benefits of the change are.
  • 9. SoberIT Software Business and Engineering Institute Requirements Change Management Process (4/5) Deciding on a change request: • Change requests are considered formally by a group or a person who decide whether or not the change should be accepted.
  • 10. SoberIT Software Business and Engineering Institute Requirements Change Management Process (5/5) Implementing a change: • Updating the requirements document. • Informing all the necessary people.
  • 11. SoberIT Software Business and Engineering Institute Traceability • Requirements cannot be managed effectively without requirements traceability [Kot98]. • Traceability types [Som97] • requirements - sources • requirements - rationale • requirements - requirements • requirements - architecture • requirements - test cases
  • 12. SoberIT Software Business and Engineering Institute Summary (1/2) User requirements definition User requirements management Design, coding and system testing Acceptance testing Requirements Engineering Useful and Successful Products
  • 13. SoberIT Software Business and Engineering Institute Summary (2/2) Systematic requirements change management ensures that product development produces useful and succesful systems.
  • 14. SoberIT Software Business and Engineering Institute References • [Kot98] G. Kotonya and I. Sommerville, Requirements Engineering - Processes and Techniques, John Wiley & Sons, New York, 1998. • [Som97] I. Sommerville and P. Sawyer, Requirements Engineering - A Good Practice Guide, John Wiley & Sons, New York, 1997.