SlideShare una empresa de Scribd logo
1 de 5
Descargar para leer sin conexión
Insight From 25+ Industry Experts From
Major E&P And Midstream Companies and
Regulatory Authorities
David Griesinger
Managing Director
DCP Midstream, L.P
Darrel Hagerman
VP Commercial
Crestwood Midstream
Partners LP
Bob Dunn
President And CEO
Prism Midstream LLC
Jeff Fawcett
Managing Director
NorTex Midstream Partners
Hershal Wolfe
VP Marketing
Pioneer Natural Resources
Jerry McLaughlin
VP Oil & Gas Marketing
Cimarex Energy
Drew Ward
Manager, Business Development
Kinder Morgan Midstream
Mark Gorman
SVP Operations &
Business Development
Plains All American Pipeline L.P
www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com
P	PRODUCTION FORECASTS: Quantifying how production from established
and emerging plays will impact demand for existing and upcoming midstream capacity
P	CRUDE PIPELINE & RAIL TAKEAWAY: Delivering the latest construction plans,
timelines, directions and capacities of crude pipeline and rail projects to forecast the
availability of crude oil takeaway
P	PRICING & MARKETS: Assessing how an increase in crude production and takeaway
infrastructure will affect pricing and how to reach high prices for oil as refineries become
more saturated
PREFINERY CAPACITY: Identifying where to market crude as the Gulf Coast
and Cushing refineries move towards saturation
P	GAS TAKEAWAY & MARKETING: Delivering, gathering and processing capacity updates
that can drive down the costs of transport and ensure dry gas can be marketed at profit
PNGL MARKETS: Hearing the latest fractionation and pipeline plans for NGL
and identifying downstream markets for NGL products
The Most Influential Permian Midstream Congress And The Only Event
Focused On Identifying Optimal Crude Oil, NGL And Gas Markets As Well As
Identifying The Most Economical Takeaway Infrastructure To Get It There
June 26-27 2013
Houston | Texas
Media Partners:
NATURALGAS
A M E R I C A S
Hearing The Latest Crude, Gas And NGL Production
Forecasts And Delivering The Very Latest Plans For
Expanding Pipeline And Rail Takeaway
Infrastructure To Handle Increased Supply
And Ensure Permian Products Reach
Optimally Priced Markets
SAVE UP
TO $200before
May 17, 2013
EXAMINING PIPELINE AND RAIL SOLUTIONS FOR OVERCOMING SHORT-TERM
TAKEAWAY CHALLENGES AND FORECASTING HOW NEW INFRASTRUCTURE
WILL IMPACT PRICING
Organized By:
www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com
As the Permian basin’s crude oil, NGL
and gas production reaches the highest
level since 1990’s, and with new shale
plays such as the Cline continuing
to drive production volumes, both
producers and midstream operators
are urgently seeking the most efficient
takeaway infrastructure solutions for
taking the products to optimally priced
markets. More pipeline projects are
being constructed and continually being
planned, and now, railroads are being
hailed as the next transportation method
to allow producers to take advantage of
oil price differentials by moving crude
from inland oil fields to coastal refineries
that pay higher prices.
The mission of the 2nd Annual
Permian Basin Markets And Takeaway
Infrastructure Congress is to build
communication among E&P, midstream
companies and refiners operating in and
around the Permian Basin to identify
optimal markets for crude oil, NGL
products and natural gas, identify the
most efficient takeaway options for taking
them to the most lucrative markets and
drive forward infrastructure build out.
Over two days, E&P and midstream
strategic professionals will gather to
deliver the latest crude oil, NGL and gas
production profiles, the latest timings,
capacities and locations of pipeline
takeaway, crude-by-rail takeaway and
processing infrastructure. Speakers
and delegates will have the opportunity
to communicate with the refineries
to assess the quality and quantity of
products being accepted and evaluate
both micro and macro factors affecting
midstream investment to mitigate risk in
new ventures and enable the more rapid
development of infrastructure.
Houston Marriott at the Texas
Medical Center
6580 Fannin Street
Houston, Texas 77030
Phone: 1 713 796 0080
The Summit Will Be Held At:
June 26-27 2013
Houston | Texas
Day one will focus on crude oil examining
the latest crude oil production plans in
the Permian. Presenters will compare the
economics of rail and pipeline takeaway,
deliver the very latest capacity, timings and
location updates on pipe and rail facilities
coming to take crude out of the Permian
and hear from the refineries on how they
plan to handle an influx of crude to identify
the optimal markets for crude oil.
Day two will focus on NGL and Gas starting
with the very latest production updates
from operators in the basin. Presenters will
then deliver the takeaway and processing
plans for NGL and gas in the Permian
Basin, identify the optimal markets for
both products and address regulatory and
permitting issues to minimize delays on
midstream build out and ensure product
can continue being marketed.
Sponsorship And Exhibition Opportunities At Permian Basin Markets & Takeaway
Infrastructure Congress 2013
Need to generate new sales leads, launch a new product, engage key decision makers, build new future business
relationships in key markets, or simply educate the industry about a new product? Then you need to exhibit at the
Permian Basin Markets And Takeaway Infrastructure Congress. Our busy exhibit area is an integral part of the Summit and
is of genuine practical value to delegates, who are looking for new solutions and technologies. Exhibiting at the conference
will help you position yourself as a market leader and center of excellence to the key decision makers in the industry.
For further information, please email: info@american-business-conferences.com
or call: (1) 800 721 3915
Day one will examine the latest crude oil production plans
in the Permian, compare the economics of rail and pipeline
takeaway and hear from the refineries to identify the optimal
markets for crude oil
8.30 Chair’s Opening Remarks
Chaired By: Darrel Hagerman, Vice President Commercial Development,
Crestwood Midstream Partners LP
KEYNOTE: FORECASTING CRUDE PRODUCTION
8.40 Estimating Drilling And Production Profiles In The
Permian Basin To Identify Areas Of Increased Activity And
Midstream Investment Opportunities
•	Calculatingwhatbasin-wideproductionisgoingtolooklikeinthenext
3-5yearstoforecastwhetherornotthePermianwillrealisticallyreach
theanticipatedfigureof2millionbpd
•	Establishedplays:examiningtheaggressivenessofdrilling
programsintheWolfcamp,SpraberryAndBoneSpringstoquantify
infrastructurecapacityrequired
•	EvaluatingthecostsofdifferentdrillingmethodsinthePermian
Basintounderstandtheirimpactsoneconomicsandultimately,the
sustainabilityofproduction
•	Assessinghowlatestregulationsandthefracingpermittingprocess
couldcausepotentialproductionslowdowns
Hershal Wolfe, Vice President Marketing, Pioneer Natural Resources
9.10 Question & Answer Session
PRODUCTION: CLINE & UPPER WOLFCAMP
9.20 Cline And Upper Wolfcamp Shale Play Focus: Hearing A
Leading Operator’s Forecasts On Cline and upper Wolfcamp
Production Volumes Over The Next 5-10 Years
•	Productionrates:LatestupdatesfromaClineandWolfcampoperator
showingtheproductionvolumefromtheiracreage
•	Producttypes:Analyzingtheproducttypesexpectedtodetermine
whattypesofmidstreaminfrastructureareneededtosuccessfully
commercialiseproductionplans
•	Locations:Geologicallymappingthearea’smostconcentratedproduction
areastoidentifywheremidstreaminvestmentsaremostneeded
Keith Skarr, Vice President Exploration, Element Petroleum
9.50 Question & Answer Session
PERMIAN BASIN OVERVIEW
9.20 Hearing A Leading Operator’s Forecasts on Production
Growth And Takeaway Capacity Over The Next 5-10 Years
•	AnalyzingOxyMidstreamandCenturionPipelineplans
•	Evaluatingproductiongrowthandproducttypesexpectedtoprojectthe
demandfordifferenttypesofmidstreaminfrastructure
•	Discussinganynewexpansionprojectsonthehorizontounderstandif
supplywillbeabletomeetincreaseddemandandalleviatebottlenecks
•	UnderstandingthekeymarketdriversinPermianproductionand
infrastructureexpansion
Rick Van Eyk, Vice President Midstream, Occidental Petroleum Corporation
9.50 Question & Answer Session
10.00 Morning Refreshments In Exhibition Showcase Area
CRUDE
ASSESSINGCRUDETAKEAWAYOPTIONS,REFINERYDEMANDAND
PRICINGDIFFERENTIALSTOENSURECRUDEFROMTHEPERMIAN
BASINREACHESTHEHIGHESTNETBACK
FREEDOM PROJECT : WEST COAST PERSPECTIVE
10.30 Understanding The Latest News Surrounding The
Freedom Pipeline Project To Assess The Increased Capacity
For Taking Crude To The West Coast Markets
•	Providingacurrentupdateonanoilpipelinethatwouldmovecrudeoil
fromthePermianBasinthroughSouthernNewMexicotorefineries
inCalifornia
•	UnderstandingthebarrelsofoilperdaycapacityoftheFreedomPipeline
Projectanddetermineitsimpactoncurrenttakeawaycapacitylimitations
•	Discussingthestartdateandtimelineforconstructiontounderstand
whentheprojectwillbefullyimplemented
Tom Dobson, Director, KinderMorgan
11.00 Question & Answer Session
CRUDE PIPELINES PLANS
11.10 Hearing The Latest Construction Plans, Timelines,
Directions And Capacities Of Crude Oil Pipeline Projects To
Forecast The Availability Of Crude Oil Takeaway
•	NewProjects:updatesontheverylatestcrudeoilpipelineproject
plansinthePermianbasinandwhoisfundingthem
•	Capacity:examiningthecapacityofthepipelineexpansionsand
whethertheywillbeabletomatchproductiongrowth
•	Timeline:hearingwhentheexistinglargeon-goingprojectswillbe
availableforuseandhowtheywillaffectflowdynamicsinthePermian
•	Directions:identifyingwheremajorpipelineprojectsaregoingother
thanCushing
RandyGeiselman,ExecutiveVicePresident&Director,AdvantagePipelineL.L.C.
Mark Gorman, Vice President Marketing, Plains All American Pipeline L.P
12.10 Question & Answer Session
12.25 Lunch In The Exhibition Showcase Area
CRUDE RAIL UPDATE: CASE STUDY 1
1.25 Understanding How The Kinder-Watco Express Is Going
To Help Alleviate Strains On Pipeline Infrastructure
•	ExplainingwhattheKinder-WatcoExpressentailstounderstandthe
projectasameanstoovercomelackofpipelineinfrastructure
•	ProvidinganupdateonthedevelopmentofthenewTecosTexasterminal
•	Addressingthelongleaditemsformovingcrudebyrail:timelineand
railcaravailability
•	Pipelineupdate-AnalyzingpipelinestotheGulfCoast&WestCoast
fromthePermianBasin
Allan Roach, Senior Vice President, Kinder-Watco Express
1.55 Question & Answer Session
CRUDE RAIL UPDATE: CASE STUDY 2
2.05 Delivering Updates On Crude Rail Takeaway Projects As
A Means Of Overcoming The Lack Of Pipeline Infrastructure
•	Mappingtheavailablerailfacilitiesandtheircapacityformovingcrude
outofthePermianBasin
•	Identifyingwheretherailroadsaretakingtheoilandtheratiobetween
volumesgoingtotheGulfCoastandWestCoast
•	Hearingthelatesttimelinesonrailprojectstoidentifyexactlywhen
theywillbeavailableforuse
•	AnalyzingthepossibilityofrailingcrudetotheWestCoasttoassessrail
asfeasiblesolutionfortakingrudetolesstraditionalmarkets
Shannon Flowers, Vice President - Crude, Crosstex Energy
2.35 Question & Answer Session
RAILING VS PIPELINE: ECONOMICS
2.45 Comparing The Costs And Market Destinations Of Rail
And Pipeline To Establish Which Takeaway Solution Will
Achieve The Highest Netback
•	Identifyingthecostsavingsthatcouldpotentiallybeachievedbyusing
railratherthanpipelines
•	Casestudy:hearinghowaPermianoperatorisusingrailasalong-
termsolutionforcrudetakeaway
•	Hearingthepricedifferentialsthathavebeenachievedbyusingrailas
opposedtopipeline
•	ComparingthecostsofbuildingpipelinesandrailcrudetotheGulf
coastComparingthecostsofbuildingpipelinesandrailcrudetothe
WestCoast
DarrelHagerman,VicePresidentCommercial,CrestwoodMidstreamPartnersL.P
3.15 Question & Answer Session
3.25 Afternoon Refreshments In Exhibition Showcase Area
PRICING,MARKETS&REFINERYDEMAND
ASSESSINGHOWANINCREASEINMARKETABLECRUDEWILL
AFFECTPRICINGANDHOWTOREACHHIGHPRICESFOROILASTHE
REFINERIESBECOMEMORESATURATED
PANEL: TAKEAWAY IMPACT ON PRICING
3.55 How New Takeaway Developments Will Impact The
Price That Can Be Achieved For Permian Crude To Calculate
The Economics Of Future Production
•	ForecastinghowcrudepricingwillbeimpactedintheGulfandCushing
whenmidstreaminfrastructurebringsmoresupplyintothemarket
•	LonghornCaseStudy:Examininghowthelonghornpipelinewillaffect
pricedifferentials
•	UsinghistoricalmarketdatatoforecastdifferentialsbetweenWTIand
Brentinthenext5-10years
•	Estimatinghowpricechangesoverthenext5-10yearswillimpact
productioneconomics
Jerry Mclaughlin, Vice President Oil & Gas Marketing, Cimarex Energy Co.
GULF COAST REFINERIES
4.15 Comparing Gulf Coast Refinery Capacity With Permian
Production Forecasts To Assess How The Market Will Handle
An Increase In Crude Production
•	Hearingarefineryperspectiveonhowrefineriesplantohandlean
influxofcrudecomingdowntotheGulfCoast
•	Quantifyingthecurrentcapacityofrefineriesintheareatoassessthe
pointatwhichthemarketwillbecomefull
•	HearingplansforincreasingrefinerycapacityintheGulfCoastand
whenitwillbeavailable
4.45 Question & Answer Session
REFINERY SPECIFICATIONS
4.55ExaminingTheQualityOfProductsRefineriesAreNow
AcceptingToPinpointWhereToTakeEachTypeOfPermianCrude
•	DiscussingthechangingproductionqualitiescomingfromnewPermian
playstoforecastwhichtypeofcrudewillbeinhighestsupply
•	HearinganoverallupdateonwhatkindofcrudequalityGulfCoast
refineriesaretaking
•	Hearinghowrefineriesareretoolingtokeepupwiththeproduction
•	Examiningtheoptionsforhandlingtheinfluxoflightsweetcrude
whentherefineriesaresetupforprocessingsourcrude
•	AssessingtheGulfCoastRefineriescapacityandabilitytohandleH2S:
whereisthesafetylimitation
Anthony Andrews, Specialist in Energy and Defense Policy, Congressional
Research Service
5.25 Question & Answer Session
WEST COAST REFINERIES FOCUS
5.35 Analyzing The Economics Of Taking Crude To The West
Coast To Evaluate The Region As A Viable Market Long-Term
•	AccessingmarketdemandforcrudeinCaliforniaRegiontoevaluate
thepossibilityofrefiningcrudeintheregion
•	Examiningdifferentfactorsthatinfluencethecommercialviabilityof
refiningcrudeinCaliforniatoevaluateitasalong-termmarketing
solution:Costofrailingproductsintotheregion
•	AvailablerailandpipelinecapacityfortakingcrudetotheCaliforniaregion
•	Localenvironmentalandregulatorylimitations
6.05 Question & Answer Session
6.15 Chair’s Closing Remarks
6.20 - 7.20 Networking Drinks Reception In Exhibition
	 Showcase Area
Day One
Wednesday June 26, 2013
CRUDE PRODUCTION,
TAKEAWAY, REFINERIES,
PRICING AND MARKETS
www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com
Day two will review the latest production, takeaway and
processing plans for NGL and gas in the Permian Basin, identify
the optimal markets for gas and NGL and address regulatory
and permitting issues to minimize delays on midstream build
out and ensure product can continue being marketed
8.30 Chair’s Opening Remarks
OPERATOR CASE STUDY 1 : GAS AND NGL
PRODUCTION UPDATE
8.40 Understanding How Gas And NGL Production Is
Increasing To Understand How Increased Supply Will Affect
Product Pricing
•	MappingNGLproductionvolumesacrossthePermianBasinto
identifyareasofhighproductionconcentration
•	DeliveringupdatesfromOpalResoucesshowingreservesrecovery
todatefromtheiracreageandhowmuchmoretheyplantoproduce
•	Analyzingproducttypesbeingforecastedintheregiontodetermine
whattypeofpipelineinfrastructureisneeded
•	Drillingoutlook:forecastinghowdrillingplanswillevolveinlightof
changinggaspricesandidentifyingatwhatpointdrillingforgas
becomesuneconomic
Rick Lester, CEO, Opal Resources
9.10 Question & Answer Session
OPERATOR CASE STUDY 2: GAS AND NGL
PRODUCTION UPDATE
9.20 Providing A Second Perspective On Projected Gas
And NGL Production Levels To Determine How Production
Updates Will Affect Commodity Pricing
•	MappingNGLproductionvolumestounderstandtotalsupplythatis
likelytoemergefromthePermianBasin
•	DeliveringproductionupdatesfromNadel&Gussmanto
understandprojectedproductioninthenearfuture
•	Analyzingproducttypesbeingforecastedintheregiontodetermine
whattypeofpipelineinfrastructureisneeded
•	Drillingoutlook:forecastinghowdrillingplanswillevolveinlightof
changinggaspricesandidentifyingatwhatpointdrillingfordrygas
becomesuneconomic
Jennifer Greenwell, Manager Marketing, Nadel & Gussman, LLC
9.50 Question & Answer Session
10.00 Morning Refreshments In Exhibition Showcase Area
GASTAKEAWAY&PROCESSING
DELIVERINGGATHERINGANDPROCESSINGCAPACITYUPDATES
TODRIVEDOWNTHECOSTSOFTRANSPORTANDENSUREDRY
GASCANSTILLBEMARKETED
GAS GATHERING PLANS
10.30 Examining The Capacity And Direction Of Gas
Gathering Lines To Ensure The Products Can Be Quickly
Taken From Well Pad To The Mainline Pipeline
•	Discussingthecapacityofavailablegatheringfacilitiesand
comparingagainstproductionestimatestoidentifytheneedof
furthergatheringlines
•	Detailingthelocationsforresidualgasgatheringprojectstounderstand
wherethegatheringlineswillconnectwithmainlinepipelines
•	Comparingtheeconomicsofavailabletruckingandgathering
pipelineinfrastructuretoevaluatethemostcostefficientmethodfor
gettinggasontheroutetomarkets
Drew Ward, Manager, Business Development, KinderMorgan
11.00 Question & Answer Session
GAS GATHERING - GAS STUDY
11.10 Hearing From A Leading Operator About The Latest
Gas Gathering Build Out Plans
•	Examiningthedetailsandtimingsofthenewgasgatheringand
processingplantsthatwillbeaccessibletoPermianoperators
•	Detailingthenitrogenrejectionandpotentialstorageprojectsinthe
RoswellArea
•	LatestPlans:DaggerDrawGasProcessingPlantandShoebarGas
ProcessingPlantoverview
•	ComparingtheadvantagesanddrawbacksofusingAcidgas
injection(AGI)systemstoimprovethecosteffectivenesswhen
designingorexpandinggasprocessingplants
J.B Smith, President, Agave Energy Company
11.40 Question & Answer Session
11.50 Lunch In Exhibition Showcase Area
GAS PROCESSING: CASE STUDY 1
12.50 Mapping New Gas Processing And LNG Compression
Facilities That Have Either Both Approved Or Are Soon To
Start Construction In The Permian Basin
•	AssessingwherePermianBasindrygascanbeprocessed
afterproduction
•	Identifyingwhichcompaniesareinvestingingasprocessing
facilitiesinthenext5years
•	ExaminingavailableGasprocessingcapacityintheregionto
meetdemand
•	DeliveringupdatesonnewLNGcompressingprojects:thetype
ofprojects,wheretheprojectswillbeandwhothemidstream
sponsorsare
Bob Dunn, President, Prism Midstream LLC
1.20 Question & Answer Session
GAS PROCESSING: CASE STUDY 2
1.30 Discussing All New Gas Processing Opportunities: Both
Already Approved And New Project Developments
•	ReviewingthehistoryofgasprocessinginthePermianBasin
•	UnderstandingDCPMidstream’sstrategyforlong-termsustainability
•	Assessingthepace&commitmentingrowthstrategiesto
understandhowtheywillunfoldovertime
David Griesinger, Managing Director, DCP Midstream, LP
2.00 Question & Answer Session
NGLFRACTIONATION&TAKEAWAY
HEARINGTHELATESTFRACTIONATIONANDPIPELINE
PLANSFORNGLANDIDENTIFYINGDOWNSTREAMMARKETS
FORNGLPRODUCTS
NGL FRACTIONATION CAPACITY
2.10 Assessing The Latest Plans For Expanding Fractionation
Plants In The Region To Identify How Much Extra Processing
Capacity Will Be Offered And When It Can Be Accessed
•	Plans:Deliveringupdatesonthelatestconstructionplansfor
expansionoffractionationplantsinthePermian
•	Companies:Hearingwhichcompaniesareinvestingin
infrastructure,whicharebuildingthemoutandhowtosubscribe
inadvance
•	Capacity:Specifyingtheprocessingplantscapacityandwhenthey
willbeavailabletouse
Steve Spaulding, Senior Vice President, Energy Transfer
2.40 Question & Answer Session
NGL PIPELINE PLANS
2.50 Pipeline Plans For Taking NGL Out Of The Permian:
Construction Timelines, Capacities And Tariffs
•	Casestudies:deliveringupdatesonthetwonewNGLpipeline
projectsbeingexecutedinthePermianBasin
•	Hearingwheretheterminalswillbeandwhatmarketsthe
pipelineswillreach
•	Quantifyingthecapacitythatwillbeofferedandwhenitwillbe
availableforoperatorstouse
•	AssessinghowNGLpriceaffectsthejustifiabilityofinfrastructure
investmentandwhetherthiswillholdbackfurtherbuildoutinthe
PermianBasin
Chris Tennant, Vice President, Crosstex Energy
3.20 Question & Answer Session
3.30 Afternoon Refreshments In Exhibition Showcase Area
PERMITTING&REGULATIONS
ASSESSINGHOWTOSWIFTLYATTAINPIPELINEPERMITSIN
THEPERMIANBASINTOENSUREPROJECTSCANCONSISTENTLY
BEDELIVEREDONTIME
PIPLEINE PERMITTING & REGULATION
4.00 Hearing Exactly What Is Required From The
Regulators And What Can Be Done To Expedite The Permit
Approval Process
•	Latestupdatesfromstateandfederalregulatorsonrecent
changesthathavebeenmadeandhowthishasaffectedthe
applicationprocess
•	Identifyingplansforchanges:findingoutinadvancewhatwillbe
requiredinthenextfewyears
•	Listingtherequirementsforattainingpermitsandidentifyingon
whichareasmoretimeandmoneywillneedtobespentthanothers
•	CaseStudy:hearingfromstarttofinishhowtheoperatorworked
withtheregulatorstoattainpermitsanddeliveratimely
midstreamproject
Mike Tupper, Branch Chief, Bureau of Land Management
Polly McDonald, Director, Texas Rail Road Commission
5.00 Question & Answer Session
MITIGATING MIDSTREAM INVESTMENT RISK
5.10 Evaluating Both The Micro And Macro Liabilities Of
Midstream Investment In The Permian And Identifying How
To Mitigate Risk
•	HearingthelatestmidstreamJointVenturedealsthathavebeen
doneandhowthecollaborationwillleadtomorecost-effective
assetprovision
•	DiscussinghowfutureJointVenturesandMergerscouldleadto
lucrativecommercialopportunities
•	Examiningthepoliticalandenvironmentalfactorsthatput
midstreaminvestmentatrisks
•	Detailingthetypesofassettradingactivitiescurrentlytakingplacein
themidstreamindustrytounderstandcurrentinvestmenttrends
Jeff Fawcett, Managing Director, Nortex Midstream Partners
5.40 Question & Answer Session
5.50 Chair’s Closing Remarks And End Of Conference
Day Two
Thursday June 27, 2013
NGL & GAS PRODUCTION VOLUMES,
MARKETS, TAKEAWAY UPDATES,
PROCESSING PLANS AND REGULATIONS
www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com
DETAILS 	 PLEASE USE CAPITALS	 Please photocopy for multiple delegates
Delegate 1 	 *Miss	 *Ms	 *Mrs	 *Mr	 *Dr	 *Other:
Name
Position
Delegate 2 	 *Miss	 *Ms	 *Mrs	 *Mr	 *Dr	 *Other:
Name
Position
Organization
Address
Country 		 Zip Code
Telephone		Fax
Email		Signature
DELEGATE RATES		 We have group discounts so you can involve your whole organization or team
DELEGATE FEES 	 (Guests are responsible for their own travel and accommodation arrangements)	
		 Early Booking Discount	 Standard Rate
		 Book and pay before May 17, 2013	 From May 18, 2013
2 Day Conference Plus Conference Audio Proceedings	 	 	 *	 US $1898 (Save $200)	 *	 US $2098
2 Day Conference	 		 *	 US $1599 (Save $200)	 *	 US $1799
I am unable to attend the event and would like to purchase online access to the speaker presentation slides, plus audio files	 *	US $499
HOW TO REGISTER	
Please Return Your Completed Registration Form To Our Customer Service Team
Call 	 (1) 800 721 3915
Fax 	 (1) 800 714 1359
Email 	 info@american-business-conferences.com
Online 	 www.permian-basin-markets-2013.com
Address 	 City Centre One 800 Town & Country Blvd Suite 300 Texas 77024
Terms and Conditions
The conference is being organized
by American Business Conferences,
a division of London Business
Conferences Ltd, a limited liability
company formed under English
company law and registered in the UK
no. 5090859.
Cancellations received one calendar
month (or the previous working day
whichever is the earliest) before the
event will be eligible for a refund less
$150 administration fee. Cancellations
must be made in writing. After that
point no refund can be made. If you
are unable to attend, no refund can
be given but you may nominate a
colleague to take your place.
American Business Conferences
reserves the right to alter or cancel
thespeakers or program. Receipt of
thibooking form, inclusive or exclusive
of payment constitutes formal
agreement to attend and acceptance
of the terms and conditions stated.
*If you are claiming the early booking
discount this may not be used in
conjunction with other discounts
advertised elsewhere.
We would like to keep you informed of
other American Business Conferences
products and services. This will be
carried out in accordance with the
Data Protection Act. Please write to
the Head of Marketing, American
Business Conferences at the address
below if you specifically do not want
to receive this information.
American Business Conferences. 2300
M Street, NW. Suite 800. Washington,
DC 20037. USA
American Business Conferences will
not accept liability for any individual
transport delays and in such
circumstances the normal cancellation
restrictions apply. American Business
Conferences is a Division of London
Business Conferences Limited,
Registered in England No. 5090859
EIN. no: 98-0514924
PAYMENT	 Please tick appropriate boxes and complete details
Payment must be received in full prior to the event. 	
* Check	 I enclose a check in US Dollars payable to London Business Conferences for $
* Payment by Wire Transfer	 A copy of the bank transfer document should be attached to your registration form so appropriate allocation of funds can be made to your registration.
Bank Name: Barclays Bank Account Name: London Business Conferences Account Number: 42331166 SWIFTBIC: BARCGB22 IBAN: GB59BARC20982142331166 EIN: 98-051 4924
Please charge my	 *Visa	 *American Express	 *Mastercard
Expiry date
Security Code / CVV (required)
Signature of card holder
Amount $
Card number
Name on card
I would like to register the delegate(s) below for
the 2 day conference Permian Markets And
Takeaway Infrastructure Congress
PYes
www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com

Más contenido relacionado

La actualidad más candente

MARS Meeting Summer 2015-North American Energy Revolution-Implications for Rail
MARS Meeting Summer 2015-North American Energy Revolution-Implications for RailMARS Meeting Summer 2015-North American Energy Revolution-Implications for Rail
MARS Meeting Summer 2015-North American Energy Revolution-Implications for RailPLG Consulting
 
Plg rail summit 2015 04-30
Plg rail summit 2015 04-30Plg rail summit 2015 04-30
Plg rail summit 2015 04-30PLG Consulting
 
A Supply Chain Design Approach to Petroleum Distribution
A Supply Chain Design Approach to Petroleum DistributionA Supply Chain Design Approach to Petroleum Distribution
A Supply Chain Design Approach to Petroleum DistributionWaqas Tariq
 
Sr Cost Estimator-Resume (July 2016)-Pankaj Kisnadwala
Sr Cost Estimator-Resume (July 2016)-Pankaj KisnadwalaSr Cost Estimator-Resume (July 2016)-Pankaj Kisnadwala
Sr Cost Estimator-Resume (July 2016)-Pankaj KisnadwalaPankaj Kisnadwala
 
Lng flyer04 final
Lng flyer04 finalLng flyer04 final
Lng flyer04 finalMECint
 
PLG Consulting Appalachian logistics League May 5, 2015
PLG Consulting Appalachian logistics League May 5, 2015PLG Consulting Appalachian logistics League May 5, 2015
PLG Consulting Appalachian logistics League May 5, 2015PLG Consulting
 

La actualidad más candente (7)

MARS Meeting Summer 2015-North American Energy Revolution-Implications for Rail
MARS Meeting Summer 2015-North American Energy Revolution-Implications for RailMARS Meeting Summer 2015-North American Energy Revolution-Implications for Rail
MARS Meeting Summer 2015-North American Energy Revolution-Implications for Rail
 
Logistics201208 dl
Logistics201208 dlLogistics201208 dl
Logistics201208 dl
 
Plg rail summit 2015 04-30
Plg rail summit 2015 04-30Plg rail summit 2015 04-30
Plg rail summit 2015 04-30
 
A Supply Chain Design Approach to Petroleum Distribution
A Supply Chain Design Approach to Petroleum DistributionA Supply Chain Design Approach to Petroleum Distribution
A Supply Chain Design Approach to Petroleum Distribution
 
Sr Cost Estimator-Resume (July 2016)-Pankaj Kisnadwala
Sr Cost Estimator-Resume (July 2016)-Pankaj KisnadwalaSr Cost Estimator-Resume (July 2016)-Pankaj Kisnadwala
Sr Cost Estimator-Resume (July 2016)-Pankaj Kisnadwala
 
Lng flyer04 final
Lng flyer04 finalLng flyer04 final
Lng flyer04 final
 
PLG Consulting Appalachian logistics League May 5, 2015
PLG Consulting Appalachian logistics League May 5, 2015PLG Consulting Appalachian logistics League May 5, 2015
PLG Consulting Appalachian logistics League May 5, 2015
 

Similar a Permian Markets And Takeaway Infrastructure Congress

Mississippi Lime & Chert Drilling & Completions Conference 2013
 Mississippi Lime & Chert Drilling & Completions Conference 2013 Mississippi Lime & Chert Drilling & Completions Conference 2013
Mississippi Lime & Chert Drilling & Completions Conference 2013jon shepherd
 
Canadian NGL Markets, Infrastructure and LPG Exports Congress
Canadian NGL Markets, Infrastructure and LPG Exports CongressCanadian NGL Markets, Infrastructure and LPG Exports Congress
Canadian NGL Markets, Infrastructure and LPG Exports Congressmarketinglbcg
 
Condensate Markets, Export & Takeaway Capacity 2014
Condensate Markets, Export & Takeaway Capacity 2014Condensate Markets, Export & Takeaway Capacity 2014
Condensate Markets, Export & Takeaway Capacity 2014marketinglbcg
 
Mercer Capital's Value Focus: Exploration and Production | Q2 2016
Mercer Capital's Value Focus: Exploration and Production | Q2 2016Mercer Capital's Value Focus: Exploration and Production | Q2 2016
Mercer Capital's Value Focus: Exploration and Production | Q2 2016Mercer Capital
 
Propane to Propylene Markets Summit 2015
Propane to Propylene Markets Summit 2015 Propane to Propylene Markets Summit 2015
Propane to Propylene Markets Summit 2015 marketinglbcg
 
North American Crude Markets & Storage Summit
North American Crude Markets & Storage Summit   North American Crude Markets & Storage Summit
North American Crude Markets & Storage Summit Brian Adams
 
Bill Young CV September
Bill Young CV  SeptemberBill Young CV  September
Bill Young CV SeptemberBill Young
 
Bill young cv september
Bill young cv  septemberBill young cv  september
Bill young cv septemberBill Young
 
On-Campus PresentationNovember 2, 20171Bac.docx
On-Campus PresentationNovember 2, 20171Bac.docxOn-Campus PresentationNovember 2, 20171Bac.docx
On-Campus PresentationNovember 2, 20171Bac.docxcherishwinsland
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resumeBill Young
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resumeBill Young
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resumeBill Young
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resumeBill Young
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resumeBill Young
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resumeBill Young
 
OMAN DOWNSTREAM EXHIBITION & CONFERENCE 2017 BROCHURE
OMAN DOWNSTREAM EXHIBITION & CONFERENCE 2017 BROCHUREOMAN DOWNSTREAM EXHIBITION & CONFERENCE 2017 BROCHURE
OMAN DOWNSTREAM EXHIBITION & CONFERENCE 2017 BROCHUREEbrahim Taher
 
U.S. Ethane & LPG Export: ASIA 2015
U.S. Ethane & LPG Export: ASIA 2015U.S. Ethane & LPG Export: ASIA 2015
U.S. Ethane & LPG Export: ASIA 2015marketinglbcg
 
Mercer Capital's Value Focus: Exploration and Production | Q3 2016
Mercer Capital's Value Focus: Exploration and Production | Q3 2016Mercer Capital's Value Focus: Exploration and Production | Q3 2016
Mercer Capital's Value Focus: Exploration and Production | Q3 2016Mercer Capital
 
OilGasTransport8
OilGasTransport8OilGasTransport8
OilGasTransport8biasinger
 

Similar a Permian Markets And Takeaway Infrastructure Congress (20)

Mississippi Lime & Chert Drilling & Completions Conference 2013
 Mississippi Lime & Chert Drilling & Completions Conference 2013 Mississippi Lime & Chert Drilling & Completions Conference 2013
Mississippi Lime & Chert Drilling & Completions Conference 2013
 
Canadian NGL Markets, Infrastructure and LPG Exports Congress
Canadian NGL Markets, Infrastructure and LPG Exports CongressCanadian NGL Markets, Infrastructure and LPG Exports Congress
Canadian NGL Markets, Infrastructure and LPG Exports Congress
 
Condensate Markets, Export & Takeaway Capacity 2014
Condensate Markets, Export & Takeaway Capacity 2014Condensate Markets, Export & Takeaway Capacity 2014
Condensate Markets, Export & Takeaway Capacity 2014
 
Mercer Capital's Value Focus: Exploration and Production | Q2 2016
Mercer Capital's Value Focus: Exploration and Production | Q2 2016Mercer Capital's Value Focus: Exploration and Production | Q2 2016
Mercer Capital's Value Focus: Exploration and Production | Q2 2016
 
Propane to Propylene Markets Summit 2015
Propane to Propylene Markets Summit 2015 Propane to Propylene Markets Summit 2015
Propane to Propylene Markets Summit 2015
 
North American Crude Markets & Storage Summit
North American Crude Markets & Storage Summit   North American Crude Markets & Storage Summit
North American Crude Markets & Storage Summit
 
Crude by Rail 2014
Crude by Rail 2014Crude by Rail 2014
Crude by Rail 2014
 
Bill Young CV September
Bill Young CV  SeptemberBill Young CV  September
Bill Young CV September
 
Bill young cv september
Bill young cv  septemberBill young cv  september
Bill young cv september
 
On-Campus PresentationNovember 2, 20171Bac.docx
On-Campus PresentationNovember 2, 20171Bac.docxOn-Campus PresentationNovember 2, 20171Bac.docx
On-Campus PresentationNovember 2, 20171Bac.docx
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resume
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resume
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resume
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resume
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resume
 
William n young bio & resume
William n young bio &  resumeWilliam n young bio &  resume
William n young bio & resume
 
OMAN DOWNSTREAM EXHIBITION & CONFERENCE 2017 BROCHURE
OMAN DOWNSTREAM EXHIBITION & CONFERENCE 2017 BROCHUREOMAN DOWNSTREAM EXHIBITION & CONFERENCE 2017 BROCHURE
OMAN DOWNSTREAM EXHIBITION & CONFERENCE 2017 BROCHURE
 
U.S. Ethane & LPG Export: ASIA 2015
U.S. Ethane & LPG Export: ASIA 2015U.S. Ethane & LPG Export: ASIA 2015
U.S. Ethane & LPG Export: ASIA 2015
 
Mercer Capital's Value Focus: Exploration and Production | Q3 2016
Mercer Capital's Value Focus: Exploration and Production | Q3 2016Mercer Capital's Value Focus: Exploration and Production | Q3 2016
Mercer Capital's Value Focus: Exploration and Production | Q3 2016
 
OilGasTransport8
OilGasTransport8OilGasTransport8
OilGasTransport8
 

Último

Market Sizes Sample Report - 2024 Edition
Market Sizes Sample Report - 2024 EditionMarket Sizes Sample Report - 2024 Edition
Market Sizes Sample Report - 2024 EditionMintel Group
 
Islamabad Escorts | Call 03070433345 | Escort Service in Islamabad
Islamabad Escorts | Call 03070433345 | Escort Service in IslamabadIslamabad Escorts | Call 03070433345 | Escort Service in Islamabad
Islamabad Escorts | Call 03070433345 | Escort Service in IslamabadAyesha Khan
 
8447779800, Low rate Call girls in Uttam Nagar Delhi NCR
8447779800, Low rate Call girls in Uttam Nagar Delhi NCR8447779800, Low rate Call girls in Uttam Nagar Delhi NCR
8447779800, Low rate Call girls in Uttam Nagar Delhi NCRashishs7044
 
Future Of Sample Report 2024 | Redacted Version
Future Of Sample Report 2024 | Redacted VersionFuture Of Sample Report 2024 | Redacted Version
Future Of Sample Report 2024 | Redacted VersionMintel Group
 
Call US-88OO1O2216 Call Girls In Mahipalpur Female Escort Service
Call US-88OO1O2216 Call Girls In Mahipalpur Female Escort ServiceCall US-88OO1O2216 Call Girls In Mahipalpur Female Escort Service
Call US-88OO1O2216 Call Girls In Mahipalpur Female Escort Servicecallgirls2057
 
Call Girls in DELHI Cantt, ( Call Me )-8377877756-Female Escort- In Delhi / Ncr
Call Girls in DELHI Cantt, ( Call Me )-8377877756-Female Escort- In Delhi / NcrCall Girls in DELHI Cantt, ( Call Me )-8377877756-Female Escort- In Delhi / Ncr
Call Girls in DELHI Cantt, ( Call Me )-8377877756-Female Escort- In Delhi / Ncrdollysharma2066
 
Organizational Structure Running A Successful Business
Organizational Structure Running A Successful BusinessOrganizational Structure Running A Successful Business
Organizational Structure Running A Successful BusinessSeta Wicaksana
 
8447779800, Low rate Call girls in Tughlakabad Delhi NCR
8447779800, Low rate Call girls in Tughlakabad Delhi NCR8447779800, Low rate Call girls in Tughlakabad Delhi NCR
8447779800, Low rate Call girls in Tughlakabad Delhi NCRashishs7044
 
India Consumer 2024 Redacted Sample Report
India Consumer 2024 Redacted Sample ReportIndia Consumer 2024 Redacted Sample Report
India Consumer 2024 Redacted Sample ReportMintel Group
 
(Best) ENJOY Call Girls in Faridabad Ex | 8377087607
(Best) ENJOY Call Girls in Faridabad Ex | 8377087607(Best) ENJOY Call Girls in Faridabad Ex | 8377087607
(Best) ENJOY Call Girls in Faridabad Ex | 8377087607dollysharma2066
 
Memorándum de Entendimiento (MoU) entre Codelco y SQM
Memorándum de Entendimiento (MoU) entre Codelco y SQMMemorándum de Entendimiento (MoU) entre Codelco y SQM
Memorándum de Entendimiento (MoU) entre Codelco y SQMVoces Mineras
 
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptxContemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptxMarkAnthonyAurellano
 
International Business Environments and Operations 16th Global Edition test b...
International Business Environments and Operations 16th Global Edition test b...International Business Environments and Operations 16th Global Edition test b...
International Business Environments and Operations 16th Global Edition test b...ssuserf63bd7
 
8447779800, Low rate Call girls in Shivaji Enclave Delhi NCR
8447779800, Low rate Call girls in Shivaji Enclave Delhi NCR8447779800, Low rate Call girls in Shivaji Enclave Delhi NCR
8447779800, Low rate Call girls in Shivaji Enclave Delhi NCRashishs7044
 
Case study on tata clothing brand zudio in detail
Case study on tata clothing brand zudio in detailCase study on tata clothing brand zudio in detail
Case study on tata clothing brand zudio in detailAriel592675
 
Flow Your Strategy at Flight Levels Day 2024
Flow Your Strategy at Flight Levels Day 2024Flow Your Strategy at Flight Levels Day 2024
Flow Your Strategy at Flight Levels Day 2024Kirill Klimov
 
Ms Motilal Padampat Sugar Mills vs. State of Uttar Pradesh & Ors. - A Milesto...
Ms Motilal Padampat Sugar Mills vs. State of Uttar Pradesh & Ors. - A Milesto...Ms Motilal Padampat Sugar Mills vs. State of Uttar Pradesh & Ors. - A Milesto...
Ms Motilal Padampat Sugar Mills vs. State of Uttar Pradesh & Ors. - A Milesto...ShrutiBose4
 
Kenya Coconut Production Presentation by Dr. Lalith Perera
Kenya Coconut Production Presentation by Dr. Lalith PereraKenya Coconut Production Presentation by Dr. Lalith Perera
Kenya Coconut Production Presentation by Dr. Lalith Pereraictsugar
 
Digital Transformation in the PLM domain - distrib.pdf
Digital Transformation in the PLM domain - distrib.pdfDigital Transformation in the PLM domain - distrib.pdf
Digital Transformation in the PLM domain - distrib.pdfJos Voskuil
 
Annual General Meeting Presentation Slides
Annual General Meeting Presentation SlidesAnnual General Meeting Presentation Slides
Annual General Meeting Presentation SlidesKeppelCorporation
 

Último (20)

Market Sizes Sample Report - 2024 Edition
Market Sizes Sample Report - 2024 EditionMarket Sizes Sample Report - 2024 Edition
Market Sizes Sample Report - 2024 Edition
 
Islamabad Escorts | Call 03070433345 | Escort Service in Islamabad
Islamabad Escorts | Call 03070433345 | Escort Service in IslamabadIslamabad Escorts | Call 03070433345 | Escort Service in Islamabad
Islamabad Escorts | Call 03070433345 | Escort Service in Islamabad
 
8447779800, Low rate Call girls in Uttam Nagar Delhi NCR
8447779800, Low rate Call girls in Uttam Nagar Delhi NCR8447779800, Low rate Call girls in Uttam Nagar Delhi NCR
8447779800, Low rate Call girls in Uttam Nagar Delhi NCR
 
Future Of Sample Report 2024 | Redacted Version
Future Of Sample Report 2024 | Redacted VersionFuture Of Sample Report 2024 | Redacted Version
Future Of Sample Report 2024 | Redacted Version
 
Call US-88OO1O2216 Call Girls In Mahipalpur Female Escort Service
Call US-88OO1O2216 Call Girls In Mahipalpur Female Escort ServiceCall US-88OO1O2216 Call Girls In Mahipalpur Female Escort Service
Call US-88OO1O2216 Call Girls In Mahipalpur Female Escort Service
 
Call Girls in DELHI Cantt, ( Call Me )-8377877756-Female Escort- In Delhi / Ncr
Call Girls in DELHI Cantt, ( Call Me )-8377877756-Female Escort- In Delhi / NcrCall Girls in DELHI Cantt, ( Call Me )-8377877756-Female Escort- In Delhi / Ncr
Call Girls in DELHI Cantt, ( Call Me )-8377877756-Female Escort- In Delhi / Ncr
 
Organizational Structure Running A Successful Business
Organizational Structure Running A Successful BusinessOrganizational Structure Running A Successful Business
Organizational Structure Running A Successful Business
 
8447779800, Low rate Call girls in Tughlakabad Delhi NCR
8447779800, Low rate Call girls in Tughlakabad Delhi NCR8447779800, Low rate Call girls in Tughlakabad Delhi NCR
8447779800, Low rate Call girls in Tughlakabad Delhi NCR
 
India Consumer 2024 Redacted Sample Report
India Consumer 2024 Redacted Sample ReportIndia Consumer 2024 Redacted Sample Report
India Consumer 2024 Redacted Sample Report
 
(Best) ENJOY Call Girls in Faridabad Ex | 8377087607
(Best) ENJOY Call Girls in Faridabad Ex | 8377087607(Best) ENJOY Call Girls in Faridabad Ex | 8377087607
(Best) ENJOY Call Girls in Faridabad Ex | 8377087607
 
Memorándum de Entendimiento (MoU) entre Codelco y SQM
Memorándum de Entendimiento (MoU) entre Codelco y SQMMemorándum de Entendimiento (MoU) entre Codelco y SQM
Memorándum de Entendimiento (MoU) entre Codelco y SQM
 
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptxContemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
 
International Business Environments and Operations 16th Global Edition test b...
International Business Environments and Operations 16th Global Edition test b...International Business Environments and Operations 16th Global Edition test b...
International Business Environments and Operations 16th Global Edition test b...
 
8447779800, Low rate Call girls in Shivaji Enclave Delhi NCR
8447779800, Low rate Call girls in Shivaji Enclave Delhi NCR8447779800, Low rate Call girls in Shivaji Enclave Delhi NCR
8447779800, Low rate Call girls in Shivaji Enclave Delhi NCR
 
Case study on tata clothing brand zudio in detail
Case study on tata clothing brand zudio in detailCase study on tata clothing brand zudio in detail
Case study on tata clothing brand zudio in detail
 
Flow Your Strategy at Flight Levels Day 2024
Flow Your Strategy at Flight Levels Day 2024Flow Your Strategy at Flight Levels Day 2024
Flow Your Strategy at Flight Levels Day 2024
 
Ms Motilal Padampat Sugar Mills vs. State of Uttar Pradesh & Ors. - A Milesto...
Ms Motilal Padampat Sugar Mills vs. State of Uttar Pradesh & Ors. - A Milesto...Ms Motilal Padampat Sugar Mills vs. State of Uttar Pradesh & Ors. - A Milesto...
Ms Motilal Padampat Sugar Mills vs. State of Uttar Pradesh & Ors. - A Milesto...
 
Kenya Coconut Production Presentation by Dr. Lalith Perera
Kenya Coconut Production Presentation by Dr. Lalith PereraKenya Coconut Production Presentation by Dr. Lalith Perera
Kenya Coconut Production Presentation by Dr. Lalith Perera
 
Digital Transformation in the PLM domain - distrib.pdf
Digital Transformation in the PLM domain - distrib.pdfDigital Transformation in the PLM domain - distrib.pdf
Digital Transformation in the PLM domain - distrib.pdf
 
Annual General Meeting Presentation Slides
Annual General Meeting Presentation SlidesAnnual General Meeting Presentation Slides
Annual General Meeting Presentation Slides
 

Permian Markets And Takeaway Infrastructure Congress

  • 1. Insight From 25+ Industry Experts From Major E&P And Midstream Companies and Regulatory Authorities David Griesinger Managing Director DCP Midstream, L.P Darrel Hagerman VP Commercial Crestwood Midstream Partners LP Bob Dunn President And CEO Prism Midstream LLC Jeff Fawcett Managing Director NorTex Midstream Partners Hershal Wolfe VP Marketing Pioneer Natural Resources Jerry McLaughlin VP Oil & Gas Marketing Cimarex Energy Drew Ward Manager, Business Development Kinder Morgan Midstream Mark Gorman SVP Operations & Business Development Plains All American Pipeline L.P www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com P PRODUCTION FORECASTS: Quantifying how production from established and emerging plays will impact demand for existing and upcoming midstream capacity P CRUDE PIPELINE & RAIL TAKEAWAY: Delivering the latest construction plans, timelines, directions and capacities of crude pipeline and rail projects to forecast the availability of crude oil takeaway P PRICING & MARKETS: Assessing how an increase in crude production and takeaway infrastructure will affect pricing and how to reach high prices for oil as refineries become more saturated PREFINERY CAPACITY: Identifying where to market crude as the Gulf Coast and Cushing refineries move towards saturation P GAS TAKEAWAY & MARKETING: Delivering, gathering and processing capacity updates that can drive down the costs of transport and ensure dry gas can be marketed at profit PNGL MARKETS: Hearing the latest fractionation and pipeline plans for NGL and identifying downstream markets for NGL products The Most Influential Permian Midstream Congress And The Only Event Focused On Identifying Optimal Crude Oil, NGL And Gas Markets As Well As Identifying The Most Economical Takeaway Infrastructure To Get It There June 26-27 2013 Houston | Texas Media Partners: NATURALGAS A M E R I C A S Hearing The Latest Crude, Gas And NGL Production Forecasts And Delivering The Very Latest Plans For Expanding Pipeline And Rail Takeaway Infrastructure To Handle Increased Supply And Ensure Permian Products Reach Optimally Priced Markets SAVE UP TO $200before May 17, 2013 EXAMINING PIPELINE AND RAIL SOLUTIONS FOR OVERCOMING SHORT-TERM TAKEAWAY CHALLENGES AND FORECASTING HOW NEW INFRASTRUCTURE WILL IMPACT PRICING Organized By:
  • 2. www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com As the Permian basin’s crude oil, NGL and gas production reaches the highest level since 1990’s, and with new shale plays such as the Cline continuing to drive production volumes, both producers and midstream operators are urgently seeking the most efficient takeaway infrastructure solutions for taking the products to optimally priced markets. More pipeline projects are being constructed and continually being planned, and now, railroads are being hailed as the next transportation method to allow producers to take advantage of oil price differentials by moving crude from inland oil fields to coastal refineries that pay higher prices. The mission of the 2nd Annual Permian Basin Markets And Takeaway Infrastructure Congress is to build communication among E&P, midstream companies and refiners operating in and around the Permian Basin to identify optimal markets for crude oil, NGL products and natural gas, identify the most efficient takeaway options for taking them to the most lucrative markets and drive forward infrastructure build out. Over two days, E&P and midstream strategic professionals will gather to deliver the latest crude oil, NGL and gas production profiles, the latest timings, capacities and locations of pipeline takeaway, crude-by-rail takeaway and processing infrastructure. Speakers and delegates will have the opportunity to communicate with the refineries to assess the quality and quantity of products being accepted and evaluate both micro and macro factors affecting midstream investment to mitigate risk in new ventures and enable the more rapid development of infrastructure. Houston Marriott at the Texas Medical Center 6580 Fannin Street Houston, Texas 77030 Phone: 1 713 796 0080 The Summit Will Be Held At: June 26-27 2013 Houston | Texas Day one will focus on crude oil examining the latest crude oil production plans in the Permian. Presenters will compare the economics of rail and pipeline takeaway, deliver the very latest capacity, timings and location updates on pipe and rail facilities coming to take crude out of the Permian and hear from the refineries on how they plan to handle an influx of crude to identify the optimal markets for crude oil. Day two will focus on NGL and Gas starting with the very latest production updates from operators in the basin. Presenters will then deliver the takeaway and processing plans for NGL and gas in the Permian Basin, identify the optimal markets for both products and address regulatory and permitting issues to minimize delays on midstream build out and ensure product can continue being marketed. Sponsorship And Exhibition Opportunities At Permian Basin Markets & Takeaway Infrastructure Congress 2013 Need to generate new sales leads, launch a new product, engage key decision makers, build new future business relationships in key markets, or simply educate the industry about a new product? Then you need to exhibit at the Permian Basin Markets And Takeaway Infrastructure Congress. Our busy exhibit area is an integral part of the Summit and is of genuine practical value to delegates, who are looking for new solutions and technologies. Exhibiting at the conference will help you position yourself as a market leader and center of excellence to the key decision makers in the industry. For further information, please email: info@american-business-conferences.com or call: (1) 800 721 3915
  • 3. Day one will examine the latest crude oil production plans in the Permian, compare the economics of rail and pipeline takeaway and hear from the refineries to identify the optimal markets for crude oil 8.30 Chair’s Opening Remarks Chaired By: Darrel Hagerman, Vice President Commercial Development, Crestwood Midstream Partners LP KEYNOTE: FORECASTING CRUDE PRODUCTION 8.40 Estimating Drilling And Production Profiles In The Permian Basin To Identify Areas Of Increased Activity And Midstream Investment Opportunities • Calculatingwhatbasin-wideproductionisgoingtolooklikeinthenext 3-5yearstoforecastwhetherornotthePermianwillrealisticallyreach theanticipatedfigureof2millionbpd • Establishedplays:examiningtheaggressivenessofdrilling programsintheWolfcamp,SpraberryAndBoneSpringstoquantify infrastructurecapacityrequired • EvaluatingthecostsofdifferentdrillingmethodsinthePermian Basintounderstandtheirimpactsoneconomicsandultimately,the sustainabilityofproduction • Assessinghowlatestregulationsandthefracingpermittingprocess couldcausepotentialproductionslowdowns Hershal Wolfe, Vice President Marketing, Pioneer Natural Resources 9.10 Question & Answer Session PRODUCTION: CLINE & UPPER WOLFCAMP 9.20 Cline And Upper Wolfcamp Shale Play Focus: Hearing A Leading Operator’s Forecasts On Cline and upper Wolfcamp Production Volumes Over The Next 5-10 Years • Productionrates:LatestupdatesfromaClineandWolfcampoperator showingtheproductionvolumefromtheiracreage • Producttypes:Analyzingtheproducttypesexpectedtodetermine whattypesofmidstreaminfrastructureareneededtosuccessfully commercialiseproductionplans • Locations:Geologicallymappingthearea’smostconcentratedproduction areastoidentifywheremidstreaminvestmentsaremostneeded Keith Skarr, Vice President Exploration, Element Petroleum 9.50 Question & Answer Session PERMIAN BASIN OVERVIEW 9.20 Hearing A Leading Operator’s Forecasts on Production Growth And Takeaway Capacity Over The Next 5-10 Years • AnalyzingOxyMidstreamandCenturionPipelineplans • Evaluatingproductiongrowthandproducttypesexpectedtoprojectthe demandfordifferenttypesofmidstreaminfrastructure • Discussinganynewexpansionprojectsonthehorizontounderstandif supplywillbeabletomeetincreaseddemandandalleviatebottlenecks • UnderstandingthekeymarketdriversinPermianproductionand infrastructureexpansion Rick Van Eyk, Vice President Midstream, Occidental Petroleum Corporation 9.50 Question & Answer Session 10.00 Morning Refreshments In Exhibition Showcase Area CRUDE ASSESSINGCRUDETAKEAWAYOPTIONS,REFINERYDEMANDAND PRICINGDIFFERENTIALSTOENSURECRUDEFROMTHEPERMIAN BASINREACHESTHEHIGHESTNETBACK FREEDOM PROJECT : WEST COAST PERSPECTIVE 10.30 Understanding The Latest News Surrounding The Freedom Pipeline Project To Assess The Increased Capacity For Taking Crude To The West Coast Markets • Providingacurrentupdateonanoilpipelinethatwouldmovecrudeoil fromthePermianBasinthroughSouthernNewMexicotorefineries inCalifornia • UnderstandingthebarrelsofoilperdaycapacityoftheFreedomPipeline Projectanddetermineitsimpactoncurrenttakeawaycapacitylimitations • Discussingthestartdateandtimelineforconstructiontounderstand whentheprojectwillbefullyimplemented Tom Dobson, Director, KinderMorgan 11.00 Question & Answer Session CRUDE PIPELINES PLANS 11.10 Hearing The Latest Construction Plans, Timelines, Directions And Capacities Of Crude Oil Pipeline Projects To Forecast The Availability Of Crude Oil Takeaway • NewProjects:updatesontheverylatestcrudeoilpipelineproject plansinthePermianbasinandwhoisfundingthem • Capacity:examiningthecapacityofthepipelineexpansionsand whethertheywillbeabletomatchproductiongrowth • Timeline:hearingwhentheexistinglargeon-goingprojectswillbe availableforuseandhowtheywillaffectflowdynamicsinthePermian • Directions:identifyingwheremajorpipelineprojectsaregoingother thanCushing RandyGeiselman,ExecutiveVicePresident&Director,AdvantagePipelineL.L.C. Mark Gorman, Vice President Marketing, Plains All American Pipeline L.P 12.10 Question & Answer Session 12.25 Lunch In The Exhibition Showcase Area CRUDE RAIL UPDATE: CASE STUDY 1 1.25 Understanding How The Kinder-Watco Express Is Going To Help Alleviate Strains On Pipeline Infrastructure • ExplainingwhattheKinder-WatcoExpressentailstounderstandthe projectasameanstoovercomelackofpipelineinfrastructure • ProvidinganupdateonthedevelopmentofthenewTecosTexasterminal • Addressingthelongleaditemsformovingcrudebyrail:timelineand railcaravailability • Pipelineupdate-AnalyzingpipelinestotheGulfCoast&WestCoast fromthePermianBasin Allan Roach, Senior Vice President, Kinder-Watco Express 1.55 Question & Answer Session CRUDE RAIL UPDATE: CASE STUDY 2 2.05 Delivering Updates On Crude Rail Takeaway Projects As A Means Of Overcoming The Lack Of Pipeline Infrastructure • Mappingtheavailablerailfacilitiesandtheircapacityformovingcrude outofthePermianBasin • Identifyingwheretherailroadsaretakingtheoilandtheratiobetween volumesgoingtotheGulfCoastandWestCoast • Hearingthelatesttimelinesonrailprojectstoidentifyexactlywhen theywillbeavailableforuse • AnalyzingthepossibilityofrailingcrudetotheWestCoasttoassessrail asfeasiblesolutionfortakingrudetolesstraditionalmarkets Shannon Flowers, Vice President - Crude, Crosstex Energy 2.35 Question & Answer Session RAILING VS PIPELINE: ECONOMICS 2.45 Comparing The Costs And Market Destinations Of Rail And Pipeline To Establish Which Takeaway Solution Will Achieve The Highest Netback • Identifyingthecostsavingsthatcouldpotentiallybeachievedbyusing railratherthanpipelines • Casestudy:hearinghowaPermianoperatorisusingrailasalong- termsolutionforcrudetakeaway • Hearingthepricedifferentialsthathavebeenachievedbyusingrailas opposedtopipeline • ComparingthecostsofbuildingpipelinesandrailcrudetotheGulf coastComparingthecostsofbuildingpipelinesandrailcrudetothe WestCoast DarrelHagerman,VicePresidentCommercial,CrestwoodMidstreamPartnersL.P 3.15 Question & Answer Session 3.25 Afternoon Refreshments In Exhibition Showcase Area PRICING,MARKETS&REFINERYDEMAND ASSESSINGHOWANINCREASEINMARKETABLECRUDEWILL AFFECTPRICINGANDHOWTOREACHHIGHPRICESFOROILASTHE REFINERIESBECOMEMORESATURATED PANEL: TAKEAWAY IMPACT ON PRICING 3.55 How New Takeaway Developments Will Impact The Price That Can Be Achieved For Permian Crude To Calculate The Economics Of Future Production • ForecastinghowcrudepricingwillbeimpactedintheGulfandCushing whenmidstreaminfrastructurebringsmoresupplyintothemarket • LonghornCaseStudy:Examininghowthelonghornpipelinewillaffect pricedifferentials • UsinghistoricalmarketdatatoforecastdifferentialsbetweenWTIand Brentinthenext5-10years • Estimatinghowpricechangesoverthenext5-10yearswillimpact productioneconomics Jerry Mclaughlin, Vice President Oil & Gas Marketing, Cimarex Energy Co. GULF COAST REFINERIES 4.15 Comparing Gulf Coast Refinery Capacity With Permian Production Forecasts To Assess How The Market Will Handle An Increase In Crude Production • Hearingarefineryperspectiveonhowrefineriesplantohandlean influxofcrudecomingdowntotheGulfCoast • Quantifyingthecurrentcapacityofrefineriesintheareatoassessthe pointatwhichthemarketwillbecomefull • HearingplansforincreasingrefinerycapacityintheGulfCoastand whenitwillbeavailable 4.45 Question & Answer Session REFINERY SPECIFICATIONS 4.55ExaminingTheQualityOfProductsRefineriesAreNow AcceptingToPinpointWhereToTakeEachTypeOfPermianCrude • DiscussingthechangingproductionqualitiescomingfromnewPermian playstoforecastwhichtypeofcrudewillbeinhighestsupply • HearinganoverallupdateonwhatkindofcrudequalityGulfCoast refineriesaretaking • Hearinghowrefineriesareretoolingtokeepupwiththeproduction • Examiningtheoptionsforhandlingtheinfluxoflightsweetcrude whentherefineriesaresetupforprocessingsourcrude • AssessingtheGulfCoastRefineriescapacityandabilitytohandleH2S: whereisthesafetylimitation Anthony Andrews, Specialist in Energy and Defense Policy, Congressional Research Service 5.25 Question & Answer Session WEST COAST REFINERIES FOCUS 5.35 Analyzing The Economics Of Taking Crude To The West Coast To Evaluate The Region As A Viable Market Long-Term • AccessingmarketdemandforcrudeinCaliforniaRegiontoevaluate thepossibilityofrefiningcrudeintheregion • Examiningdifferentfactorsthatinfluencethecommercialviabilityof refiningcrudeinCaliforniatoevaluateitasalong-termmarketing solution:Costofrailingproductsintotheregion • AvailablerailandpipelinecapacityfortakingcrudetotheCaliforniaregion • Localenvironmentalandregulatorylimitations 6.05 Question & Answer Session 6.15 Chair’s Closing Remarks 6.20 - 7.20 Networking Drinks Reception In Exhibition Showcase Area Day One Wednesday June 26, 2013 CRUDE PRODUCTION, TAKEAWAY, REFINERIES, PRICING AND MARKETS www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com
  • 4. Day two will review the latest production, takeaway and processing plans for NGL and gas in the Permian Basin, identify the optimal markets for gas and NGL and address regulatory and permitting issues to minimize delays on midstream build out and ensure product can continue being marketed 8.30 Chair’s Opening Remarks OPERATOR CASE STUDY 1 : GAS AND NGL PRODUCTION UPDATE 8.40 Understanding How Gas And NGL Production Is Increasing To Understand How Increased Supply Will Affect Product Pricing • MappingNGLproductionvolumesacrossthePermianBasinto identifyareasofhighproductionconcentration • DeliveringupdatesfromOpalResoucesshowingreservesrecovery todatefromtheiracreageandhowmuchmoretheyplantoproduce • Analyzingproducttypesbeingforecastedintheregiontodetermine whattypeofpipelineinfrastructureisneeded • Drillingoutlook:forecastinghowdrillingplanswillevolveinlightof changinggaspricesandidentifyingatwhatpointdrillingforgas becomesuneconomic Rick Lester, CEO, Opal Resources 9.10 Question & Answer Session OPERATOR CASE STUDY 2: GAS AND NGL PRODUCTION UPDATE 9.20 Providing A Second Perspective On Projected Gas And NGL Production Levels To Determine How Production Updates Will Affect Commodity Pricing • MappingNGLproductionvolumestounderstandtotalsupplythatis likelytoemergefromthePermianBasin • DeliveringproductionupdatesfromNadel&Gussmanto understandprojectedproductioninthenearfuture • Analyzingproducttypesbeingforecastedintheregiontodetermine whattypeofpipelineinfrastructureisneeded • Drillingoutlook:forecastinghowdrillingplanswillevolveinlightof changinggaspricesandidentifyingatwhatpointdrillingfordrygas becomesuneconomic Jennifer Greenwell, Manager Marketing, Nadel & Gussman, LLC 9.50 Question & Answer Session 10.00 Morning Refreshments In Exhibition Showcase Area GASTAKEAWAY&PROCESSING DELIVERINGGATHERINGANDPROCESSINGCAPACITYUPDATES TODRIVEDOWNTHECOSTSOFTRANSPORTANDENSUREDRY GASCANSTILLBEMARKETED GAS GATHERING PLANS 10.30 Examining The Capacity And Direction Of Gas Gathering Lines To Ensure The Products Can Be Quickly Taken From Well Pad To The Mainline Pipeline • Discussingthecapacityofavailablegatheringfacilitiesand comparingagainstproductionestimatestoidentifytheneedof furthergatheringlines • Detailingthelocationsforresidualgasgatheringprojectstounderstand wherethegatheringlineswillconnectwithmainlinepipelines • Comparingtheeconomicsofavailabletruckingandgathering pipelineinfrastructuretoevaluatethemostcostefficientmethodfor gettinggasontheroutetomarkets Drew Ward, Manager, Business Development, KinderMorgan 11.00 Question & Answer Session GAS GATHERING - GAS STUDY 11.10 Hearing From A Leading Operator About The Latest Gas Gathering Build Out Plans • Examiningthedetailsandtimingsofthenewgasgatheringand processingplantsthatwillbeaccessibletoPermianoperators • Detailingthenitrogenrejectionandpotentialstorageprojectsinthe RoswellArea • LatestPlans:DaggerDrawGasProcessingPlantandShoebarGas ProcessingPlantoverview • ComparingtheadvantagesanddrawbacksofusingAcidgas injection(AGI)systemstoimprovethecosteffectivenesswhen designingorexpandinggasprocessingplants J.B Smith, President, Agave Energy Company 11.40 Question & Answer Session 11.50 Lunch In Exhibition Showcase Area GAS PROCESSING: CASE STUDY 1 12.50 Mapping New Gas Processing And LNG Compression Facilities That Have Either Both Approved Or Are Soon To Start Construction In The Permian Basin • AssessingwherePermianBasindrygascanbeprocessed afterproduction • Identifyingwhichcompaniesareinvestingingasprocessing facilitiesinthenext5years • ExaminingavailableGasprocessingcapacityintheregionto meetdemand • DeliveringupdatesonnewLNGcompressingprojects:thetype ofprojects,wheretheprojectswillbeandwhothemidstream sponsorsare Bob Dunn, President, Prism Midstream LLC 1.20 Question & Answer Session GAS PROCESSING: CASE STUDY 2 1.30 Discussing All New Gas Processing Opportunities: Both Already Approved And New Project Developments • ReviewingthehistoryofgasprocessinginthePermianBasin • UnderstandingDCPMidstream’sstrategyforlong-termsustainability • Assessingthepace&commitmentingrowthstrategiesto understandhowtheywillunfoldovertime David Griesinger, Managing Director, DCP Midstream, LP 2.00 Question & Answer Session NGLFRACTIONATION&TAKEAWAY HEARINGTHELATESTFRACTIONATIONANDPIPELINE PLANSFORNGLANDIDENTIFYINGDOWNSTREAMMARKETS FORNGLPRODUCTS NGL FRACTIONATION CAPACITY 2.10 Assessing The Latest Plans For Expanding Fractionation Plants In The Region To Identify How Much Extra Processing Capacity Will Be Offered And When It Can Be Accessed • Plans:Deliveringupdatesonthelatestconstructionplansfor expansionoffractionationplantsinthePermian • Companies:Hearingwhichcompaniesareinvestingin infrastructure,whicharebuildingthemoutandhowtosubscribe inadvance • Capacity:Specifyingtheprocessingplantscapacityandwhenthey willbeavailabletouse Steve Spaulding, Senior Vice President, Energy Transfer 2.40 Question & Answer Session NGL PIPELINE PLANS 2.50 Pipeline Plans For Taking NGL Out Of The Permian: Construction Timelines, Capacities And Tariffs • Casestudies:deliveringupdatesonthetwonewNGLpipeline projectsbeingexecutedinthePermianBasin • Hearingwheretheterminalswillbeandwhatmarketsthe pipelineswillreach • Quantifyingthecapacitythatwillbeofferedandwhenitwillbe availableforoperatorstouse • AssessinghowNGLpriceaffectsthejustifiabilityofinfrastructure investmentandwhetherthiswillholdbackfurtherbuildoutinthe PermianBasin Chris Tennant, Vice President, Crosstex Energy 3.20 Question & Answer Session 3.30 Afternoon Refreshments In Exhibition Showcase Area PERMITTING&REGULATIONS ASSESSINGHOWTOSWIFTLYATTAINPIPELINEPERMITSIN THEPERMIANBASINTOENSUREPROJECTSCANCONSISTENTLY BEDELIVEREDONTIME PIPLEINE PERMITTING & REGULATION 4.00 Hearing Exactly What Is Required From The Regulators And What Can Be Done To Expedite The Permit Approval Process • Latestupdatesfromstateandfederalregulatorsonrecent changesthathavebeenmadeandhowthishasaffectedthe applicationprocess • Identifyingplansforchanges:findingoutinadvancewhatwillbe requiredinthenextfewyears • Listingtherequirementsforattainingpermitsandidentifyingon whichareasmoretimeandmoneywillneedtobespentthanothers • CaseStudy:hearingfromstarttofinishhowtheoperatorworked withtheregulatorstoattainpermitsanddeliveratimely midstreamproject Mike Tupper, Branch Chief, Bureau of Land Management Polly McDonald, Director, Texas Rail Road Commission 5.00 Question & Answer Session MITIGATING MIDSTREAM INVESTMENT RISK 5.10 Evaluating Both The Micro And Macro Liabilities Of Midstream Investment In The Permian And Identifying How To Mitigate Risk • HearingthelatestmidstreamJointVenturedealsthathavebeen doneandhowthecollaborationwillleadtomorecost-effective assetprovision • DiscussinghowfutureJointVenturesandMergerscouldleadto lucrativecommercialopportunities • Examiningthepoliticalandenvironmentalfactorsthatput midstreaminvestmentatrisks • Detailingthetypesofassettradingactivitiescurrentlytakingplacein themidstreamindustrytounderstandcurrentinvestmenttrends Jeff Fawcett, Managing Director, Nortex Midstream Partners 5.40 Question & Answer Session 5.50 Chair’s Closing Remarks And End Of Conference Day Two Thursday June 27, 2013 NGL & GAS PRODUCTION VOLUMES, MARKETS, TAKEAWAY UPDATES, PROCESSING PLANS AND REGULATIONS www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com
  • 5. DETAILS PLEASE USE CAPITALS Please photocopy for multiple delegates Delegate 1 *Miss *Ms *Mrs *Mr *Dr *Other: Name Position Delegate 2 *Miss *Ms *Mrs *Mr *Dr *Other: Name Position Organization Address Country Zip Code Telephone Fax Email Signature DELEGATE RATES We have group discounts so you can involve your whole organization or team DELEGATE FEES (Guests are responsible for their own travel and accommodation arrangements) Early Booking Discount Standard Rate Book and pay before May 17, 2013 From May 18, 2013 2 Day Conference Plus Conference Audio Proceedings * US $1898 (Save $200) * US $2098 2 Day Conference * US $1599 (Save $200) * US $1799 I am unable to attend the event and would like to purchase online access to the speaker presentation slides, plus audio files * US $499 HOW TO REGISTER Please Return Your Completed Registration Form To Our Customer Service Team Call (1) 800 721 3915 Fax (1) 800 714 1359 Email info@american-business-conferences.com Online www.permian-basin-markets-2013.com Address City Centre One 800 Town & Country Blvd Suite 300 Texas 77024 Terms and Conditions The conference is being organized by American Business Conferences, a division of London Business Conferences Ltd, a limited liability company formed under English company law and registered in the UK no. 5090859. Cancellations received one calendar month (or the previous working day whichever is the earliest) before the event will be eligible for a refund less $150 administration fee. Cancellations must be made in writing. After that point no refund can be made. If you are unable to attend, no refund can be given but you may nominate a colleague to take your place. American Business Conferences reserves the right to alter or cancel thespeakers or program. Receipt of thibooking form, inclusive or exclusive of payment constitutes formal agreement to attend and acceptance of the terms and conditions stated. *If you are claiming the early booking discount this may not be used in conjunction with other discounts advertised elsewhere. We would like to keep you informed of other American Business Conferences products and services. This will be carried out in accordance with the Data Protection Act. Please write to the Head of Marketing, American Business Conferences at the address below if you specifically do not want to receive this information. American Business Conferences. 2300 M Street, NW. Suite 800. Washington, DC 20037. USA American Business Conferences will not accept liability for any individual transport delays and in such circumstances the normal cancellation restrictions apply. American Business Conferences is a Division of London Business Conferences Limited, Registered in England No. 5090859 EIN. no: 98-0514924 PAYMENT Please tick appropriate boxes and complete details Payment must be received in full prior to the event. * Check I enclose a check in US Dollars payable to London Business Conferences for $ * Payment by Wire Transfer A copy of the bank transfer document should be attached to your registration form so appropriate allocation of funds can be made to your registration. Bank Name: Barclays Bank Account Name: London Business Conferences Account Number: 42331166 SWIFTBIC: BARCGB22 IBAN: GB59BARC20982142331166 EIN: 98-051 4924 Please charge my *Visa *American Express *Mastercard Expiry date Security Code / CVV (required) Signature of card holder Amount $ Card number Name on card I would like to register the delegate(s) below for the 2 day conference Permian Markets And Takeaway Infrastructure Congress PYes www.permian-basin-markets-2013.com (1)8007213915 info@american-business-conferences.com