Se está descargando su SlideShare. ×
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Epaper surya 29 juni 2013
Próxima SlideShare
Cargando en...5

Thanks for flagging this SlideShare!

Oops! An error has occurred.

Saving this for later? Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime – even offline.
Text the download link to your phone
Standard text messaging rates apply

Epaper surya 29 juni 2013


Published on

0 comentarios
0 Me gusta
  • Sea el primero en comentar

  • Be the first to like this

Sin descargas
reproducciones totales
En SlideShare
De insertados
Número de insertados
Me gusta
Insertados 0
No embeds

Denunciar contenido
Marcada como inapropiada Marcar como inapropiada
Marcar como inapropiada

Seleccione la razón para marcar esta presentación como inapropiada.

No notes for slide


  • 1. HARGA LANGGANAN: Rp 29.000/BULAN ● BERLANGGANAN/PENGADUAN/SIRKULASI: (031) 8479 555 ALAMAT REDAKSI/IKLAN: JL. RUNGKUT INDUSTRI III NO. 68 & 70 SIER SURABAYA (031) 8419 000 SURABAYA, SURYA - Sidang KomisiKodeEtikProfesi(KKEP) yang digelar oleh Bidang Pro- pam Polda Jatim, Jumat (28/6) sore, akhirnya merekomendasi si Polwan cantik Briptu Rani Indah Yuni Nugraeni dipecat alias di-PTDH (Pemberhentian Tidak Dengan Hormat) dari ke- satuannya. Kapolda Jatim Irjen Pol Ung- gung Cahyono kepada Surya membenarkan adanya rekomen- dasipemecatantersebut.Namun dikatakan Kapolda, sebelum Briptu Rani diberhentikan dari kesatuannya, dia terlebih dahu- lu harus menjalani hukuman di tempat khusus selama 21 hari karena ada kesalahan yang ha- rus dipertanggung jawabkan. “Iya, memang demikian (Brip- tu Rani dipecat). Tapi, hukuman 21 hari itu harus dijalankan dulu. Dan saat ini, dia sudah ditempatkan di tempat khusus,” jawab Kapolda Unggung Ca- hyono melalui ponselnya, Jumat malam. Sidang KKEP terhadap ang- gota Polres Mojokerto tersebut digelar di ruang Bid Propam Polda Jatim lantai tiga sejak Jumat siang sekitar pukul 14.00 WIB hingga sore sekitar pukul 16.30 WIB. Sidang berlangsung tertutup dengan penjagaan super ketat K ISAH pilu dan potret kemiskinan itu akhirnya menuai banyak simpa- ti. Salah satunya dari Menteri Pendidikan dan Kebudayaan (Mendikbud) Mohammad Nuh dan Gubernur DKI Jakarta Joko Widodo (Jokowi). Mohammad Nuh sudah bertemu Sugiyanto sekaligus memberikan solusi terkait masalah Sugiyanto. "Urusan ijazah, Kementerian akan ambil alih," kata Nuh di kantornya, Jakarta, Jumat (28/6). Nuh menjanjikan kepada Sarah Milenda Ayu, anak Sugiyanto, akan mendapatkan ijazahnya sekaligus mendapat- kan beasiswa Bidik Misi dari Kementerian Pendidikan dan Kebudayaan (Kemendikbud). Dalam kesempatan yang sama, Sugiyanto menyam- paikan terima kasih kepada Mohammad Nuh yang telah berupaya membantu dia. "Te- rima kasih Pak Menteri mau mengupayakan ijazah anak kami," kata dia. Sebelumnya, Sugiyanto nekat akan menjual ginjalnya untuk menebus ijazah SMP dan SMA milik putrinya, Ayu. Pihak seko- lah Ayu, Pondok Pesantren Al- Ashiriyyah Nurul Iman, Waru Jaya, Parung, Bogor, meminta KAPOLRES Mojokerto AKBP Eko Puji Nugroho menyatakan kesiapan dan pasrah atas pencopotan dirinya terkait kasus dugaan pelecehan terhadap anak buahnya, Briptu Rani, yang telah disidang di Propam Polda Jatim, Rabu (26/6) lalu. Saat dicegat usai salat Jumat di lingkungan Mapolres Mojokerto di Mojosari, Jumat (28/6), pria asal Semarang ini mengaku siap atas perintah pimpinannya. Meski diakui, ini adalah akhir yang tragis setelah 1,8 tahun memimpin wilayah hukum Kabupaten Mojokerto. Dengan ekspresi yang masih tampak sedih, Eko menyatakan sebagai prajurit siap menjalankan perintah atasan. "Kami sebagai anggota, siap apa yang menjadi KE HALAMAN 7■ Polwan Cantik Rani Akhirnya Dipecat KE HALAMAN 7■ WARTAKOTA/ANGGA BHAGYA NUGRAHA GINJAL - Sugiyanto dan anaknya, Sarah Milenda Ayu, saat menawar- kan ginjal untuk tebus ijazah, di Bundaran HI, Jakarta, Rabu (26/6). Demi menebus ijazah sekolah anaknya, Sugiyanto (45), warga Kalideres, Jakarta Barat, rela menjual ginjalnya. Bersama anaknya, Sarah Milenda Ayu, Sugiyanto berkeliling jalanan ibukota dengan memegang poster menyampaikan niatnya tersebut. Seorang Ayah Berjuang demi Pendidikan Anaknya Ijazah Ditebus, Sugiyanto Batal Jual Ginjal Istri Profesor Thamrin Menangis JAKARTA, SURYA - Istri Guru Besar Sosiologi Uni- veristas Indonesia (UI) Profesor Dr Thamrin Amal To- magola terusik. Dia bersedih, lalu menangis mengeta- hui Juru Bicara Front Pembela Islam (FPI) Munarman SH memperlakukan suaminya dengan kasar, menyi- ramkan air teh di gelas ke wajah Thamrin. "Istri saya langsung menangis dan meminta agar kejadian itu dilaporkan ke polisi. Saya bilang, tidak usah, biarlah publik yang menilai atas kejadian itu," kata Thamrin Amal Tomagola saat berbincang de- ngan, Jumat (28/6). Jumat pagi kemarin, sosiolog ternama ini men- dapat perlakuan tidak menyenangkan saat menjadi Langsung Double Platinum FATIN SHIDQIA F ATIN Shidqia seperti ma- gnet, bahkan sebelum ia tampil dalam Konser Su- per X. Nama Fatin menjadi sa- lah satu trending topic Twitter. Fatinistic (sebutan untuk fans Fatin) berhasil menyundul #SuperXWithFatin men- duduki peringkat kedua trending topic. Penggemarnya ti- dak sabar menunggu Fatin melantunkan single pertamanya, Aku Memilih Setia. Album yang dibanderol Rp 75.000 itu mengha- dirkan 13 finalis XFI, yakni Fatin Shidqia Lubis, Novita Dewi, Nu Dimension, Mi- kha Angelo, Shena Malsiana, Gede Bagus, Alex Rudi- art, Isa Raja, Agus Hafiluddin, Yohanna Febiana, Ilusia Girls, Dalagita, dan Dicky Adam. Konser Super X RCTI juga merilis album Kompilasi X Factor Indo- nesia. Album keroyokan itu Serapan Rumah Tipe 70 Turun Drastis Di Surabaya, Animo Tetap Tinggi■ SURABAYA, SURYA - Pertumbuhan kredit pemilikan rumah (KPR) untuk landed house (ru- mah tempat tinggal), dengan tipe di atas 70 turun drastis. Salah satunya karena ketentuan Bank In- donesia (BI) soal minimal uang muka (DP) KPR 30 persen untuk tipe ini. Kepala Divisi Ekonomi Moneter Kantor Wilayah Bank Indonesia IV Jatim, Junanto Herdiawan me- nyebutkan, hingga Desember 2012, pertumbuhan KPR mencapai 67,99 persen. Tapi pada Mei 2013, menjadi 28,06 persen, senilai Rp 8,96 triliun. "Se- tidaknya, serapan atas rumah tipe itu turun atau melambat," katanya, Jumat (28/6). Perlambatan itu tidak hanya untuk KPR tipe 70, tetapi juga pada kredit pemilikan apartemen (KPA) dengan luas bangunan yang sama. Perlam- batan juga terjadi pada kredit kendaraan bermotor setelah diterapkan kebijakan serupa (batasan uang Pelatih Spanyol Favoritkan Brasil FINAL idaman di Piala Konfe- derasi 2013 akhirnya terwujud. Juara Piala Dunia dan Eropa, Spanyol memastikan lolos ke final untuk menantang tuan rumah Brasil pada partai final yang akan berlangsung di Sta- dion bersejarah Maracana, Rio de Janeiro, Senin (1/7) dinihari. Spanyol lolos ke final setelah dengan kerja keras dan sedikit keberuntungan menundukkan Italia 7-6 lewat adu penalti. Kedua tim bermain imbang 0- 0 dalam 120 menit di babak se- mifinal, Jumat (28/6) dinihari. Jesus Navas menjadi penentu kemenangan Spanyol, setelah tendangan penaltinya berbuah gol. Sementara pemain Italia SABTU, 29 JUNI 2013 NO. 230 TAHUN XXVI TERBIT 24HALAMAN HARGA Rp 1.000 Wajah Suami Disiram Segelas Air Teh ■ NASIB BRIPTU RANI DAN AKBP EKO PUJI NUGROHO1 Sidang Komisi Kode Etik Profesi (KKEP) Polri yang digelar Bidang Propam Polda Jatim, Jumat (28/6) sore, merekomendasi Briptu Rani Indah Yuni Nugraeni dipecat. 2 Sidang tersebut terkait sejumlah kasus disiplin yang dilakukan Briptu Rani. 3 Sebelum dipecat, Briptu Rani harus menjalani hukuman selama 21 hari dengan ditempatkan di tempat khusus atau disel. 4 Rabu (26/6) lalu, Rani bersama keluarganya datang ke Polda Jatim menghadiri sidang KKEP atas kasus dugaan pelecehan yang dilaporkannya dengan terperiksa AKBP Eko Puji Nugroho. 5 Kapolres Mojokerto dinyatakan bersalah karena melakukan tindakan tidak patut, megukur baju anak buahnya. Dalam sidang itu AKBP Eko Puji dijatuhui hukuman mutasi atau dicopot dari jabatannya sebagai Kapolres. Kapolres Eko Pasrah KE HALAMAN 7■ KE HALAMAN 7■ KOMPAS/FERGANATA INDRA RIATMOKO DIGELAR MARATON - Terdakwa kasus penyerangan Lapas Kelas IIB Cebongan Sleman sekaligus anggota Kopassus Grup 2 Kandang Menjangan, Serda Ucok Simbolon (kiri), Serda Sugeng Sumaryanto, dan Koptu Kodik, memasuki ruang sidang di Pengadilan Militer II -11 Jogjakarta, Jumat (28/6). TVONE SIRAM AIR - Aksi penyiraman air teh Munarman kepada Thamrin Tamagola saat live di TVOne, Jumat (28/6).KE HALAMAN 7■ KE HALAMAN 7■ KE HALAMAN 7■ PETIKAN LAGU Bagaimana kondisi Briptu Rani selama di tahanan? YOGYAKARTA, SURYA - Majelis Hakim Pengadilan Militer II-11 Yogyakarta me- mutuskan menolak eksepsi penasihat hukum lima ter- dakwa kasus penyerangan Lembaga Pemasyarakatan (Lapas) Cebongan Sleman yang disidangkan pada ber- kas kedua, Jumat (28/6). Majelis hakim diketuai Let- kot Chk Farida Faizal menilai eksepsipenasihathukumlima terdakwa terkait peran ma- sing-masing terdakwa telah masukkedalammateripokok perkara yang akan dibuktikan dalampersidangan. Pada sidang ini mengha- dirkan lima terdakwa yakni Hakim Tolak Eksepsi Penyerang Cebongan KE HALAMAN 7■ SURYA/DOK AKBP EKO PUJI NUGROHO Rekomendasi Sidang Polda Jatim■ THE BEST OF JAVA NEWSPAPER INDONESIA PRINT MEDIA AWARD (IPMA) 2013 join follow @portalsurya
  • 2. | ROADTOELECTION SABTU, 29 JUNI 2013 | SURABAYA,SURYA -Pasang- an cagub-cawagub Bambang DH dan Said Abdullah berbagi sasaran kampanye. Bambang DH blusukan ke Bojonegoro, sedang Said Abdullah safari ke Nganjuk. Said bertemu warga Nganjuk dalam Pengajian Umum me- n y a m b u t bulan Rama- dan yang digelar ke- luarga besar p e n g a m a l Shalawat Wa- hidiyah di Gedung Wanita, Nganjuk, Jumat (28/6). Dalam kesempatan ini, Said berjanji akan menghiasi Jatim dengan sholawat. “Kalau kami dipilih dan mendapat amanah memimpin Jatim, kantor Guber- nuran kami jadikan tempat ber- shalawat. Kehadiran saya kesini kan sebagai bagian dari keluarga besar pengamal Shalawat Wahi- diyah,” tegasnya, dalam realease yang disampaikan ke Surya. Menurut Said, sebagai umat Islam, menghiasi hari dengan Shalawat perlu dilakukan. “Tak ada satupun umat Islam yang tidak membutuhkan sholawat. Badan kita, butuh amalan shol- awat itu,” terang Said yang juga Anggota DPR RI ini. JAKARTA, surya - Menteri Koordi- nator Perekonomian Hatta Rajasa dino- batkan sebagai Ketua Dewan Pembina Relawan Pedagang Kaki Lima (PKL). Pengangkatan Hatta itu dilakukan oleh Rapat Pimpinan Nasional (Rapimnas) II Asosiasi Pedagang Kaki Lima Indonesia (APKLI), Jumat (28/6).Bos“Rapimnas II APKLI memutuskan membentuk Badan Semi Otonom Relawan Kaki Lima Indo- nesia yang mana Ketua Wanbinnya ada- lah Pak Hatta Rajasa,”kata Ketua Umum DPP APKLI 2011-2016 Ali Mahsun, Ju- mat(28/6). Tidak hanya berhenti pada penobatan Hatta sebagai pembina relawan. APKLI juga menjadikan Hatta sebagai calon presi- den (capres) yang didukungnya. “APKLI akan mendampingi 25 juta PKL di seluruh tanah air untuk mengantarkan kader ter- baiknya menjadi Presiden RI Periode 2014- 2019, dan mengantarkan kader terbaik APKLI untuk terpilih menjadi anggota DPR RI, DPD RI, DPRD Propinsi, DPRD Kabupaten/Kota,” tegasnya. Hatta yang mendapat dari APKLI menyatakan akan berusaha untuk mem- perbaiki nasib PKL. Ketua Umum DPP Partai Amanat Nasional (PAN) ini meya- kini para PKL sebenarnya bisa ditata dan dikelola dengan baik. Mereka kata Hatta juga bisa memberikan kontribusi yang besar buat negara. “Mereka itu bisa ditata, dibina dan diberdayakan, serta memberikan kon- stribusi yang besar dan bagian tak terpi- sahkan dari perekonomian nasional,”ka- tanya. Hatta Rajasa juga meminta jajaran APKLI di seluruh tanah air lebih intensif berkomunikasi dan membangun sinergi dengan Pemerintah, baik pemerintah pusat maupun pemerintah daerah, dan pemangku kepentingan lainnya. “Perlu saya sampaikan bahwa Per- pres 125/2012 tentang Penataan dan Pemberdayaan PKL merupakan payung hukum yang mengikat, sebuah perintah yang harus dijalankan oleh semua pihak, baik pemerintah, BUMN, Swasta, dan pemangku kepentingan lainnya. APKLI harus mengawal pelaksanaan Perpres 125/201=2 tersebut, Insya Allah PKL ke depan naik kelas menjadi pengusaha kecil, menengah bahkan pengusaha besar,” ujar- nya. ( SURABAYA, SURYA - Ketua Umum Partai Hati Nurani Rakyat (Hanura) memilih bersikap cuek terhadap hasil survei Lembag Ilmu Pengetahuan Indonesia (LIPI). Survei ini menyebut elektabilitas Hanurahanya1,9persen. Wiranto mengaku sudah tahu hasil survei yang menempatkan elektabilitas partainya di urutan 10 daripartaipesertapemilu2014. Mantan Menteri Pertahanan dan Keamanan/Panglima TNI tersebut menyatakan dirinya tidak risau dengan hasil survei itu. Sebab menurutnya, dalam banyak survei lembaga lain, partainya masuk urutan empat besar. “Silahkan lihat hasil sur- vei lembaga lain. Suara partai kita signifikan dan ada di empat besar,” tegasnya usai memberi kuliah umum dan membuka rapat anggota tahunan (RAT) XXXII Koperasi Pemuda Indo- nesia di Kampus Unitomo, Sura- baya, Jumat (28/6). Meski hasil survei elektabi- litas Hanura rendah, pihaknya tidak akan memprotes hasil survei tersebut. Wiranto meng- aku mengembalikan semua kepada sikap masing-masing orang. “Saya ya biasa saja, wong nggak ada sarana protes. Makanya saya kembalikan dan silahkan saja anda (wartawan) bersikap,” tegas Mantan Pang- lima TNI ini. Hal yang sama juga dite- gaskan Wiranto ketika ditanya hasil survei yang menempatkan elektabilitasnya sebagai Capres kalah dibandingkan Jokowi. Elektabilitas Wiranto berada diurutan ketujuh dengan 3,4 persen. Sedangkan Jokowi di- peringkat pertama dengan 22,6 persen. Dia tak menanggapi serius hasil survei tersebut. Sebelumnya, Pusat Penelitian Politik LIPI melansir hasil survei terbaru tentang elektabilitas Capres. Berdasar survei yang dilakukan 10 - 31 Mei 2013, Jo- kowi menempati urutan perta- ma dengan 22,6 persen; disusul Prabowo Subianto 14,2 persen; Aburizal Bakrie 9,4 persen; Megawati Soekarnoputri 9,3 persen; Jusuf Kalla 4,2 persen; Rhoma Irama 3,5 persen; dan Wiranto di urutan tujuh dengan 3,4 persen; Mahfud MD 1,9 per- sen; Hatta Rajasa 1,2 persen; Sri Sultan Hamengku Buwono X 1,2 persen; Surya Paloh 1,2 persen; dan lain-lain 4,4 persen. Sedangkan untuk suara partai dalam pemilu 2014, Hanura ada di urutan ke 10, setelah PDIP 14,9 persen, Golkar 14,5 persen, De- mokrat 11,1 persen, Gerindra 7,4 persen, PKB 5,6 persen, PPP 2,9 persen, PKS 2,6 persen, PAN 2,5 persen, NasDem 2,2 persen. Ha- nura hanya unggul atas PBB 0,6 persen, dan PKPI 0,3 persen serta tak menjawab 31,1 persen. (uji) 36 Caleg Bintang Masuk Daftar Merah JAKARTA, surya - Indonesia Corruption Watch (ICW) merilis daftar merah calon anggota le- gislatif (caleg) untuk DPR. Daf- tar ini berisi 36 caleg. Sebagian besar dikenal sebagai bintang di partai masing-masing . Me- reka dimasukkan daftar merah karena diragukan komitmennya dalam pemberantasan korupsi. Sebanyak 34 caleg diantaranya adalah wajah lama yang saat ini duduk di gedung perwakilan rakyat di Senayan. Para caleg itu merupakan bin- tang partai. Mereka pengurus teras. Sebagian lagi merupakan vokalis kenamaan. Dalam daftar pencalegan 2014, mereka men- jadi unggulan partai. Mayoritas mendapat nomor urut cantik alias nomor urut atas. Dari Demokrat misalnya ada nama Edhie Bhaskoro Yudhoyo- no (Ibas), Waketum Demokrat Max Sopacua, Mirwan Amir dan Sutan Bhatoegana. Lalu dari Partai Persatuan Pembangunan (PPP) ada nama Ahmad Yani yang selama ini dikenal getol menyuarakan pengusutan kasus bail out Centurty. Selanjutnya dari Partai Gerakan Indonesia Raya (Gerindra) ada Desmond J Mahesa dan Pius Lustrilanang. Tak ketinggalan dari PKS, mun- cul nama Fahri Hamzah dan Na- sir Jamil yang selama ini dikenal sebagai vokali. Dari Golkar ada nama Bendahara DPP sekaligus Ketua Fraksi Golkar, Setya No- vanto, Wakil Ketua DPR Priyo Budi Santoso, dan Bambang Susatyo. Dalam rilis yang diterima Tribunnews (Grup Surya) Ju- mat (28/6), ICW menjelaskan penentuan rapor merah dalam pemberantasan korupsi itu di- dasarkan lima indikator. Di an- taranya nama-nama pernah di- sebut oleh keterangan saksi atau dakwaan JPU terlibat serta atau turut menerima sejumlah uang dalam sebuah kasus korupsi. Indikator lainnya, adalah bekas terpidana kasus korupsi, yang pernah dijatuhi sanksi atau terbukti melanggar etika dalam pemeriksaan oleh Badan Kehor- matan DPR dan politisi yang mengeluarkan pernyataan di media yang tidak mendukung upaya pemberantasan korupsi. Satu lagi indikator rapor merah versi ICW adalah politisi yang mendukungupayarevisiUUKPK. Padahal revisi UU itu berpotensi memangkas dan melemahkan kewenangan KPK selaku lembaga pemeberantasankorupsi. Masih berdasarkan rilis ICW, masuknya nama putra presiden itu, karana Ibas melaporkan Yulianis ke kepolisian atas dasar pencemaran nama baik. “Lapor- an dugaan pencemaran nama baik oleh Ibas kepada Yulianis dinilai oleh LPSK menghambat pemberantasan korupsi,” tulis ICW dalam rilisnya.. Tidak Fair Rapor yang dikeluarkan ICW itu mendapat reaksi keras, uta- manya dari Partai Demokrat. Sekretaris Pengembangan Stra- tegy dan Kebijakan DPP Demo- krat, Farhan Effendy menilai In- donesia Corruption Watch(ICW) sudah bersikap tidak fair dengan merilis nama-nama politisi yang tidak mendukung pemberantas- an korupsi, khususnya mereka yang berasal dari Partai Demo- krat. “Jika hanya karena beberapa kader yang belum tentu ke- benaran korupsinya, (karena belum ada putusan hukum), lalu partai kami dituduh sebagai penghambat kerja-kerja pem- berantasan korupsi, ya tidak ‘fair’ lah,” kata Farhan kepada Tribunnews, Jumat(28/6). Penyebutan beberapa nama politisi Demokrat termasuk Sek- jen Edhie Baskoro Yudhoyono sebagai orang-orang yang meng- hambat kerja KPK juga tidak masuk di nalar. Apalagi secara hukum, komentar Yulianis tidak terbukti. Lebih-lebih yulianis tidak pernah menyebut perihal Ibas dalam urusan korupsi. “Mengenai pak Ibas mela- porkan Yulianis waktu itu ke polisi, karena memang beliau benar-benar diluar urusan itu semua, dan agar Yulianis bisa mempertanggungjawabkan statemennya. Tidak ada urusan sama sekali dengan keinginan atau tujuan-tujuan menghambat proses pemberantasan korupsi. Sebenarnya sengt elok jika proses hukum yang berjalan juga meng- hargai hak orang lain apalagi beliau merasa di fitnah. Sekali lagi Demokrat, sangat semngat dan tetap mendorong kadernya agar terus membantu kerja-kerja pemberantasan korupsi. Dan ke depanpun akan demikian,”ujar Farhan. ( Wiranto Cueki Hasil Survei LIPI Ada Nama Ibas dan Priyo Budi Daftar Disusun ICW ■ ■ Para caleg bintang itu terdiri pengurus teras partai dan para vokalis di DPR Mereka dinilai lemah komitmennya dalam usaha pemberatasan korupsiIndikatornya pernah disebut oleh saksi atau jaksa dalam persidangan kasus korupsi Demokrat menilai ICW tidak fair dalam membuat daftar. ■ ■ ■ storyhighlights ANTARA FOTO/Widodo S. Jusuf KUNJUNGAN KENEGARAAN - Ketua DPR Marzuki Alie (kanan) menerima Presiden Vietnam Truong Tan Sang (kiri) di Gedung Parlemen, Jakarta, Jumat (28/6). TIM BAMBANG BERTEMU TOKOH SAMIN - Bambang DH (kanan) didamping Wakil Ketua PDIP Jatim Ali Mudji (kiri) berdialog dengan Mbah Harjo Kardo, tokoh masyarakat Samin Bojonegoro Said Dekati Jamaah Sholawat Wahidiyah Hadir dalam acara itu sejum- lah tokoh, seperti KH Abdul Majid Ma’ruf RA selaku pendiri jamaah Shalawat Wahidiyah Ke- diri, Nyai Indah Naharro Najib, Ulama Nganjuk KH Nurhadi, dan Wakil Ketua DPRD Jatim H Sirmadji. KH Nurhadi menyam- but baik apa yang disampaikan Said. Menurutnya, negeri ini di- karunia pemimpin seperti yang dicontohkan Nabi Muhammad SAW. “Makanya, semoga ada pe- mimpin yang bisa menjalankan ajaran seperti yang dicontohkan Rasulullah,” tegasnya. Sementara Bambang blu- sukan ke sejumlah lokasi di Bojonegoro. Diantaranya bertemu masyarakat Samin di Dusun Jepang, Desa/Keca- matan Margomulyo. Letaknya letaknya di tengah hutan jati. Ia diterima, didoakan dan dijamu makan bersama oleh pemimpin Samin, Harjo Kar- di, generasi ke-4 dari Ki Samin Suryosentiko, pendiri masya- rakat Samin. “Saya bersyukur telah bertemu dengan berbagai masyarakat Jawa Timur. Salah satunya, saya bertemu dengan masyarakat Samin. Saya dite- rima dan dijamu makan Mbah Harjo Kardo, pemimpin Samin yang sekarang,” jelas Bambang DH dalam press release, Jumat (28/6) pagi. (uji/ian) ANTARA KULIAH UMUM - Wiranto memberikan materi kuliah umum di Universitas dr. Soetomo (Unitomo) Surabaya, Jatim, Jumat (28/6). Hatta Pimpin Relawan PKL SURABAYA, surya - Aktivis Bidang Perempuan PKS mene- bar simpati lewat gerakan bagi- bagi sayuran kepada ibu-ibu rumah tangga, Jumat (28/6). Ge- rakan dilakukan di semua kota/ kabupaten dengan mendatangi datang secara door to door (dari pintu ke pintu). “Kami mendengar banyak keluhan masyarakat, terutama dari ibu rumah tangga, setelah kenaikan harga BBM. Makanya kami ajak kader perempuan PKS datang langsung dan bertemu ibu-ibu di rumahnya, terutama yang ekonominya masih keku- rangan”, jelas Ketua Bidang Pe- rempuan DPW PKS Jatim, Dwi Sulistyorini. Gerakan dalam rangka mem- peringati Hari Keluarga Nasio- nal (Harganas) ini digelar mulai tiga hari, hingga Minggu (28/6) besok. “Gerakan sekaligus men- jadi kampanye semangat menja- ga keluarga sehat, meski kebu- tuhan hidup makin meningkat,” kata Dwi. Ada ribuan paket sayur yang ditebar di masing-masing kota/ kabupaten. Di Surabaya misal- nya, selama sehari kemarin se- banyak 3.000 paket dibagiakan di Kelurahan Mojo dan Gubeng. “Alhamdulillah, sambutan ma- syarakat sangat baik. Saya yakin yangpentingbukanpadahadiah paketsayurnyayangmasyarakat hargai. Tapi lebih pada semangat untuk saling menguatkan di saat kebutuhan hidup makin berat”, tutur Aning Rahmati, Ketua Bi- dang Perempuan PKS Surabaya yang memimpin pembagian di Surabaya. Selain tebar sayur, perempuan PKS mendekati ibu-ibu lewat pelayanan kesehatan keluarga, pelatihan pendidikan anak, pen- dampingan usaha keluarga dan pelatihan praktis pengelolaan keuangan rumah tangga. “Pelatihan mengatur keuangan keluarga ini penting di tengah kenaikan harga-harga. Apalagi se- telahinibertepatandengandatang- nyabulanpuasa,lebarandantahun ajaran baru sekolah anak-anak”, tambah DwiSulistyorini. (ian) Perempuan PKS Tebar Sayur Door to Door surya/SUYANTO PESONA SAYUR - Anggota Bidang Perempuan PKS Surabaya Dyah Wulandari (kiri) dan Eny Minarsih mengulurkan sayur pada warga Kelurahan Mojo, Gubeng, Jumat (28/6). JAKARTA, surya - Mantan Ketua Umum Partai Demokrat (PD) Anas dan para loyalis eks- kader Demokrat mendirikan organisasi masyarakat (ormas), dengan nama Pergerakan Indo- nesia. “Tidak lama lagi segera laun- ching,” kata Tri Dianto kepada Tribunnews. (Grup Surya) Ju- mat (28/6). Tridianto merupa- kan loyalis Anas Urbaningrum. Tri dipecat dari Ketua DPC De- mokrat Cilacap karena melawan pemberhentian Anas Urbaning- rum dari Ketua Umum. Tri menjelasakan, Pergerakan Indonesia didirikan Anas Urba- ningrum bersama teman-teman seperjuangan dan loyalis-loyal- isnya di Demokrat. “Bertujuan menjembatani teman-teman, agar setelah Anas mundur jadi Ketua Umum Demokrat, ada wadahnya. Tujuannya adalah perjuangan, memperjuangkan rakyat yang tertindas oleh penguasa, mem- bela rakyat yang terkriminalisa- si oleh penguasa yang otoriter,” tutur Tri. Informasi yang diperoleh Tri- bunnews Ketua Komisi III DPR Gede Pasek Suardika ikut berga- bung dan jadi Sekjen Pergerakan Indonesia. Sementara, Ketua Umum dijabat Anas Urbaning- rum. Gede Pasek sebelumnya menjabat Ketua DPP Partai De- mokrat. (tribunnews). Anas Dirikan Ormas ANTARA FOTO Hatta Rajasa join follow @portalsurya
  • 3. Surya Biz Perkuat Pasar Rumah di Kawasan Barat surabaya, surya - Kawasan Surabaya Barat masih menjadi ido- la para pengembang, untuk mem- bangun rumah yang membidik segmenmenengahhinggaatas. Pengembang besar, seperti Ciputra, Pakuwon dan Intiland, saat ini gencar mengembangkan asetnya di kawasan ini. Selain itu, PT Fortune Mate Indonesia Tbk (Fortune) yang selama ini sudah memiliki hunian di Sura- baya Barat, juga terus mengem- bangkan proyeknya. Menurut rencana Fortune akan menggarap lahan seluas 5 hektare di Desa Sememi Benowo menjadi klaster baru, Palm Eme- rald. Bidikannya, perumahan untuk kelompok menengah. Di perumahan ini nantinya akan dibangun tiga tipe, Cala- mus (38/105), Caryota (48/120) dan Attalea (118/180). Klaster ini dijadwalkan mulai dipasar- kan September mendatang. Direktur Fortune, Aprianto Susanto mengatakan, wilayah Surabaya Barat masih akan terus berkembang secara ekonomi. Rencana pembangunan West Ring Road juga akan menjadi pendorong naiknya nilai inves- tasi di kawasan itu. Sebelumnya, Fortune sukses mengembangkan kawasan Pe- rumahan Palm Residence dan The Green Taman Sari yang juga berada di kawasan Benowo. “Respons pasar masih bagus, terlebih dengan West Ring Road yang akan dibangun Pemkot,” ujar Aprianto, dalam Public Ex- pose Fortune, Jumat (28/6). Untuk mengembangkan klas- ter baru ini Fortune menyiapkan investasi sebesar Rp 10 miliar, yang diambilkan dari capex (be- lanja modal) 2013 yang totalnya mencapai Rp 40 miliar. Sementara itu, Ciputra yang mengembangkan kawasan Surabaya Barat ke arah Utara melalui produk di Citraland Utara, juga gencar menawarkan produk. Saat ini, Citraland Utara mengembangkan kawasan Klas- ter Green Hill. Marketing Manager Citraland Utara, Ayu Asri mengatakan, pi- haknya kini fokus mempromosi- kan Green Hill, mengingat seba- gai kawasan yang baru dibuka masih tersedia banyak pilihan. Peminat rumah di kawasan Surabaya Barat cukup tinggi. Penjualan kami lancar terus, ujar Asri. Di Klaster Green Hill ini di- tawarkan beberapa pilihan tipe rumah. Salah satu tipe terbaru yang mulai ditawarkan adalah Tipe Obsidian. Untuk tipe ini memang istime- wa, pembeli bisa mendapat pilih- an luas tanah, bisa tanah dengan 120 m2 atau 180 m2, ujar Asri. Garap Pergudangan Tidak hanya  mengembangkan PalmEmerald,capexFortunejuga digunakan untuk pengembangan kawasan pergudangan Rp 25 mi- liar dan landbank Rp 5 miliar. Aprianto mengungkapkan, pembangunan dan penjualan produk perumahan Fortune tahun ini cukup dipacu, meng- ingat hingga akhir 2013 target pendapatan dari sektor housing ditetapkan sebesar Rp 35 miliar. Sepanjang 2012, Fortune mencatatkan laba bersih sebesar Rp 1,02 miliar. Pendapatan me- ningkat yang diperoleh dari sek- tor pengembangan perumahan, dengan total Rp 37,31 miliar, ujar Aprianto. (rey) surya/sugiharto Terus Ekspansi - Direktur Aprianto Soesanto (kiri) bersama Presdir Tjandra Mindharta Gozali (tengah) dan Direktur Donny Gunawan, memaparkan kinerja PT Fortune Mate Indonesia Tbk, Jumat (28/6). Optimistis Tol Kertosono- Mojokerto Tuntas Jelang Pemilu Surabaya, surya - Hingga akhir Mei 2013, pembangunan proyek tol Kertosono-Mojokerto baru tergarap sekitar 44 persen. Sementara, untuk proses pembe- basan lahan sekitar 93 persen. Legowo, Direktur PT Marga Harjaya Infrastruktur (MHI), anak perusahaan Astra Group yang menjadi investor pemba- ngunantolKertosono–Mojokerto, mengatakan proyek tol sepanjang 40,5 kilometer itu ditargetkan tuntas sebelum pemilu 2014. “Semula pemerintah menar- getkan pembangunan tuntas pada Desember 2012. Tetapi akhirnya mundur dan sekarang ditargetkan sebelum Pemilu 2014,” kata Legowo, saat ber- kunjung ke kantor redaksi Hari- an Surya, Kamis (27/6) sore. Menurut Legowo, masih terkendalanya proyek itu dise- babkan lahan yang belum sepe- nuhnya dibebaskan. Dari enam segmen proyek, masih terdapat 8,971 persen atau 158 bidang la- han yang belum berhasil dibebas- kan di 17 titik. “Seandainya lahan sudah dibebaskan semua, kami bisa saja menyelesaikan dalam enam bulan,” tambahnya. Alotnya proses pembebasan lahan, lanjut dia, disebabkan ba- nyaknya orang luar yang bukan pemilik lahan yang ikut campur. Selain itu, biasnya informasi yang diperoleh masyarakat. Masyarakat selama ini mengira bahwa setelah lahan dibebaskan, jalan tol itu akan sepenuhnya dan seterusnyamenjadimilikinvestor. “Padahal kalau selesai dibangun, jalan tol akan menjadi milik pe- merintah. Tetapi masyarakat me- nyangka tol akan menjadi milik investor,” papar Legowo. Pimpinan Proyek Seksi I tol Kertosono–Mojokerto, Yanuar menambahkan, perusahaan sa- ngat berharap agar masyarakat memahami bahwa pembangun- an jalan tol adalah untuk kepen- tingan orang banyak. Apalagi pemda juga berke- inginan meminjam jalan tol untuk dijadikan jalur mudik alternatif. “Pemerintah daerah berniat me- minjam jalan yang sudah ada un- tuk jalur mudik, meski ada yang belum selesai,” katanya. (ben) surya/dodo hawe Kebut Tol - Legowo menyampaikan progress penggarapan Tol Kertosono- Mojokerto, saat berkunjung ke kantor Harian Surya, Kamis (27/6). Manfaatkan West Ring Road■ PT Fortune Mate mengembangkan Klaster Palm Emerald, dengan tiga tipe Citraland Utara tawarkan Klaster Green Hill, salah ■ ■ satunya Tipe Obsidian yang memberikan pilihan luas tanah Pengembang merespons rencana pembangunan West Ring Road oleh pemkot ■ | HALAMAN | | SABTU, 29 JUNI 2013 storyhighlights join follow @portalsurya
  • 4. 4 | FINANCE SABTU, 29 JUNI 2013 | I I I I I 28 I I I I I 24 I I I I I 25 I I I I I 26 I I I I I 27 I I I I I 28 I I I I I 24 I I I I I 25 I I I I I 26 I I I I I 27 I I I I I 28 SURABAYA, SURYA - PT Lamicitra Nusantara Tbk se- cepat mungkin merealisasikan pembangunan gedung per- kantoran untuk mendukung kinerja perusahaan. Gedung pusat perkantoran itu menjadi salah satu solusi ketika bisnis ruang pertokoan menurun. Direktur Lamicitra Nu- santara, Priyo Setyo Budi mengatakan, secara umum pembangunan perkantoran sudah siap, tinggal menung- gu penyempurnaan desain. Gedung itu memiliki konsep green building. Untuk menerapkan konsep itu, kami harus memenuhi be- berapa kriteria, persiapannya jadi butuh waktu lebih pan- jang,” terangnya dalam Public Expose di Hotel Tunjungan, Jumat (28/6). Manajemen Lamicitra ber- usaha mewujudkan green buil- dingkarenaberniatmengambil peluang pasar. Targetnya, ada- lah para pengusaha asing yang sekarang menyukai bangunan ramah lingkungan. Kebetulan di Surabaya be- lum ada gedung yang benar- benar memberlakukan konsep itu. Lamicitra mempersiapkan Surabaya Design Center (SDC), yang dijadwalkan pengerjaan- nya pada akhir 2013. DirektutLamicitraNusantara, Robin Wijaya Gejali menambah- kan, manajemen mengaloka- sikan investasi sekitar Rp 350 miliar. Gedung ini nanti juga sebagai antisipasi mengatasi pejualan perusahaan yang me- nurun tahun ini, paparnya. Lamicitra masih mengandal- kan pemasukan dari sewa dan harga hotel yang meningkat tapi tidak ada salahnya, mem- buka kantong pendapatan dari pos lain, dengan menjual pro- duk baru. Selain berbentuk memba- ngun gedung perkantoran, produk baru lain adalah menambah pengembangan Kawasan Industri Berikat di Semarang seluas 4 hektare. Pada kesempatan paparan itu, Robin Wijaya Gejali meng- ungkapkan pula mengenai laba bersih Lamicitra selama 2012 sebesar Rp 42 miliar. Dari total laba itu, sekitar Rp 17 miliar disepakati untuk diba- gikan sebagai dividen untuk pemegang saham. (rey) SURYA/SUGIHARTO PAPARAN PUBLIK - Direktur Umum, Priyo Setiabudi (kiri) didampingi Direktur Operasional PT Lamicitra Nusantara Tbk, Robin Wijaya Gejali menyampaikan paparannya pada Public Expose di Hotel Tunjungan, Jumat (28/6). Ambil Peluang dengan Konsep Green Building Modal Cekak Harus Merger JAKARTA, SURYA - Asosiasi Asuransi Jiwa Indonesia (AAJI) kembali mengimbau anggo- tanya yang sulit memenuhi ketentuan modal minimum atau masuk pengawasan khu- sus Otoritas Jasa Keuangan (OJK) segera meleburkan diri (merger). Rekomendasi lain- nya, adalah mencari investor strategis. Sebaiknya perusahaan asu- ransi yang kecil merger atau memilih skema joint venture. Ini juga menjadi peluang bagi perusahaan asuransi untuk membeli, ujar Hendrisman Rahim, Ketua Umum AAJI seperti dikutip kontan, Jumat (29/6) malam. Hingga pekan terakhir Juni 2013, OJK telah mencabut izin usaha PT Asuransi Jiwa Nusan- tara(AJN)danPTAsuransiBumi Asih Jaya (BAJ Life) yang lama masuk dalam kategori Pembe- kuan Kegiatan Usaha (PKU). OJK melakukan PKU terha- dap BAJ karena Risk Based Ca- pital (RBC) yang sudah berada di titik negatif. Padahal, sesuai ketentuan, RBC perusahaan asuransi normalnya berada di posisi minimum 120 persen. Sekalipun izin telah dicabut, AAJI menekankan pentingnya perusahaan asuransi menyele- saikan kewajiban kepada peme- gang polis. Misalnya, OJK me- merintahkan AJN menuntaskan utang dan kewajibannya. BAJ Life yang dalam kondisi PKU, tak bisa menerbitkan po- lis baru. Perusahaan ini hanya bisa mengurus bisnis lama dan bolehmenerimapremilanjutan, tapi BAJ Life wajib membayar klaim bila ada yang jatuh tem- po, papar Hendrisman Rahim. Merger asuransi tak bisa di- pungkiri lagi. Lembaga peme- ringkat Fitch Rating memperki- rakan gelombang merger dan akuisisi mendekati kenyataan karena tingkat penetrasi rendah dan terlalu banyak pemain kecil. Tingkat penetrasi asuransi di Indonesia baru 1,7 persen dari produk domestik bruto (PDB). Jauh dibandingkan China dan India. Pemainnya lebih banyak dibandingkan Jepang (20-an asuransi, dan Malaysia (30-an asuransi). Momentummergerdanakui- sisi telah ditandai oleh pem- belian 40 persen saham Panin Life oleh Dai-ichi Life, Jepang senilai 337 juta dolar AS. Dalam waktu dekat, Sumitomo Life In- surance Co kemungkinan besar melahap saham asuransi milik PT Bank Negara Indonesia Tbk sesudah menawar 40 persen sa- ham senilai 800 juta dolar AS. Peluang akuisisi juga terbuka menyusul rencana Insurance Australia Group Ltd (IAG) dari Australia membuka bisnis di Indonesia. Seperti dikutip Bloomberg, Chief Executive Of- ficer IAG Mike Wilkins menilai Indonesia sebagai pasar mena- rik karena regulasi yang cen- derung terbuka, di antaranya terkait batas kepemilikan asing dalam perusahaan joint ventu- re yang mencapai maksimal 80 persen dari total saham. Perusahaan asuransi yang sudah membuka tangan untuk merger adalah PT Asuransi Bintang yang dimiliki PT Sriha- na Utama, PT Ngrumat Bundo Utomo, PT Warisan Kasih Bun- da dan masyarakat. Modal kami baru Rp 118 miliar, paling juga merger, jelas Direktur Finance and Support Services Asuransi Bintang, Jenry Cardo Manurung. (hri) Rekomendasi dari Asosiasi Asuransi■ Total 854 produk baru asuransi (jiwa maupun umum) terbit. Rinciannya : 741 asuransi konvensional, 113 produk baru asuransi syariah. Total 560 produk baru asuransi jiwa (65,57%), sisanya asuransi umum mencapai 294 produk (34,43%), terdiri 263 produk konvensional dan 31 produk syariah. ■ ■ ■ PRODUK 2012 HARGA EMAS PERKIRAAN PASAR 27/6 28/6 DOLAR AS/TROY OUNCE (24 KARAT) 1.236.39 1.203.21 Rp 986.000/gram MATA UANG KURS JUAL KURS BELI CNY 1,615.06 1,598.88 EUR 13,044.55 12,909.88 HKD 1,286.47 1,273.49 SGD 7,882.31 7,800.24 KURSVALAS SUMBER: BANK INDONESIASUMBER: BLOOMBERG SURABAYA,SURYA-Maskapai Sriwijaya Air menyelenggarakan program 'Holiday for Kids', yang berlangsung 1-12 Juli 2013. Selain memeriahkan liburan sekolah, program ini menjadi bentuk kepedulian Sriwijaya Air dalam memberikan apresiasi kepada anak-anak yang selesai menempuh ujian di sekolah ma- sing-masing. “Ini adalah bentuk hadiah untuk anak-anak usai kerja keras menempuh ujian untuk kenaikan atau kelulusan,” ujar Agus Soedjono, Senior Manager Corporate Communication Sri- wijaya Air. Holiday for Kids merupakan program pemberian souvenir kepada pelanggan anak-anak yang menggunakan penerbang- an Sriwijaya Air. Suvenir ini akan dibagikan pada saat berada di pesawatdan hanya berlaku bagi pelanggan yang melakukan penerbangan (outgoing) dari Jakarta dan Su- rabaya. Menurut Agus Soedjono, ada beberapa jenis suvenir yang telah disediakan, antara lain transform robot fighter. Kami siapkan 9.600 buah suvenir un- tuk dibagikan kepada pelanggan anak-anak, terangnya. Beberapa rute yang berangkat dari Bandara Juanda, yakni Su- rabaya ke Jakarta, Palangkaraya, Banjarmasin, Berau, Tarakan, lalu ke Makassar (sebagai hub) yang bisa berlanjut ke Ternate, Palu, Gorontalo, Kendari, So- riong, Ambon, Manokwari. Kemudian, Surabaya ke Denpasar, dan Kupang dan Bandung serta ke Surabaya ke Jogja. (ben) Sriwijaya Air Ikut Memeriahkan Liburan Sekolah I I I I I 24 I I I I I 25 I I I I I 26 I I I I I 27 IHSG Jakarta 5.000 4.800 4.600 4.400 4.200 Minyak/Dolar AS 150.00 120.00 90.00 60.00 30.00 Rupiah/Dolar AS 10.000 9.900 9.800 9.700 9.600 I I I I II I I I I I I I I I I I I I I I I I I II I I I I I I I I I I I I I I I I 28 I I I I I I I I I I I I I I I I I 24 I I I I I I I I I I I I I I I I I I 25 I I I I I I I I I I I I I I I I I 26 I I I I I I I I I I I I I I I I I I 27 I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I4.675,75 4.818,90 95.72 97.52 10.004 9.965 SURABAYA, SURYA - PT Indosat Tbk menyerahkan BlackBerry pertama kepada pelanggan pada 25 Juni 2013, yang melaku- kan prepurchase melalui BBQ10. Penerimanya, selebriti Okan Corneli- us dan lima pelanggan VIP. Penyerahan itu termasuk pemberian paket layanan dengan 10 keunggulan dari Indosat Mentari, yang didesain khusus untuk smart- phone, tutur Group Head Marketing Com- munications, Andrini Novie Hastuti di Galeri Kantor Pusat Indosat, beberapa waktu lalu. BB Q10 adalah smartphone dengan key- board qwerty, dilengkapi layar sentuh ber- ukuran 3,1 inci super amoled dengan resolusi 720x720 330 ppi. Selain menawarkan layanan data 12 GB/3 bulan, kecepatan 7,2 Mbps serta Indosat Su- per Wi-Fi kepada pembeli BB Q10, Indosat menghadirkan program 'Trade In' kepada se- luruh pelanggan yang berdomisili di Jakarta, Bandung, Surabaya dan Makassar. Kami berharap, pelanggan dapat meman- faatkan program spesial memiliki BB Q10 ini, serta paket layanan Indosat Mentari, tambah Andrini Novie Hastuti. Untuk Surabaya, program berlangsung tiga hari, mulai 27-29 Juni 2013 di Galeri Indosat, Jl Kayoon No 72. (hri) Serahkan BlackBerry Q10 Pertama IST PERTAMA - Okan Cornelius saat menerima BlackBerry Q10 di Galeri Indosat. join follow @portalsurya
  • 5. | JAWATIMUR| SABTU, 29 JUNI 2013 jombang, surya - Wagub Jatim yang juga Ketua Kwarda Gerakan Pramuka Jatim Saiful- lah Yusuf (Gus Ipul) mengajak para anggota Pramuka menja- uhi sekaligus memerangi per- edaran narkoba. “Kegiatan kepramukaan itu ada di antara rumah dan seko- lah. Narkoba hadir di antara Rumah dan sekolah. Maka yang bisa menekan agar adik-adik tidak terjerat narkoba adalah ikutilah kegiatan Pramuka de- ngan serius,” ujar Gus Ipul saat mengunjungiacaraPerkemahan Wirakarya Pramuka Ma’arif NU Nasional (Perwimanas) di Bumi Perkemahan Pondok Pesantren Babussalam, Kalibening, Mojo- agung, Jombang, Kamis (27/6) malam. Selain meminta menjauhi narkoba, Gus Ipul juga meminta kader Pramuka khsususnya di lingkungan LP Ma’arif NU ikut memerangi peredaran narkoba di kalangan kaum muda. “Jau- hi, sekaligus lawan peredaran narkoba,” tandas mantan Ketua Umum PP GPAnsor ini. Berdasarkan data Badan Na- sionalNarkotika(BNN),jumlah pengguna narkoba di Indonesia hingga April 2013 mencapai 4 juta orang. Dari total pengguna narkoba di Indonesia sebagian besar anak-anak usia remaja. Perwimanas yang merupa- kan perkemahan nasional bagi anggota Pramuka tingkat pene- gak di lingkungan LP Ma’arif NU, memasuki hari kelima Ju- mat (28/6). Pada penyelang- garan secara nasional untuk pertama kalinya ini, Perwima- nas diikuti oleh 2.220 anggota Pramuka Ma’arif NU dari 23 provinsi dan 32 kabupaten/ kota di Indonesia. (uto) ponorogo, surya - Ha- rapan petani melon Kabupaten Ponorogo musnah. Hasil tana- man mereka tak bisa berbuah maksimaldisebabkantingginya curah hujan. Harga pun turun drastis dari Rp 4.600 menjadi Rp 3.500 per kilogram. Buah melon yang seharusnya tumbuh dan berkembang mak- simal menjadi kerdil. Sebagian lagi membusuk karena terlalu banyak terkena air hujan. Hal itu dirasakan para peta- ni di sentra melon Desa Kori, Prayungan, dan Desa/Keca- mata Sawoo, serta Desa Besuki, Kecamatan Sambit, Kabupaten Ponorogo. Rusaknya tanaman melon karena masih terus hujan. La- han melon seharusnya kering tetapi jadi lembab. Benih akar- nya tidak bisa mekar. Akhirnya pertumbuhan melon kerdil. Ini sudah tidak bisa ditolong de- ngan obat, ujar seorang petani melon, Sujud (55) warga Desa Kori, Kecamatan Sawoo. Kasi Pengendalian Hama Pe- nyakit Tanaman, Dinas Pertani- an Pemkab Ponorogo, Muhadi mengatakan, rusaknya tana- man melon hingga tak bisa ber- buah maksimal kemungkinan besar disebab suhu ekstrem. Hal ini sangat berdampak ter- utama pada tanaman melon yang masih berusia 25 sampai 30 hari. Memang kalau suhu dan cuaca ekstrim tak bisa di- siasati dengan obat-obatan, terangnya kepada Surya, Jumat (28/6). (wan) Curah Hujan Tinggi Bikin Melon Kerdil surya/sri wahyunik kleting kuning - Angkot Jember yang kini tarifnya naik menjadi Rp 4.000, meski baru diusulkan tarif baru Rp 3.500. Kartu BLSM Mulai Dibagikan tulungagung, surya - Warga miskin yang namanya ter- catat sebagai penerima Bantuan LangsungSementaraMasyarakat (BLSM) boleh tersenyum. Tidak lama lagi mereka bakal menerima bantuan uang tunai Rp 150.000 setiap bulan. Kantor Pos Tulungagung mendistribusikan Kartu Perlin- dungan Sosial (KPS) ke puluhan kecamatan di Tulungagung dan Trenggalek mulai Jumat (28/6), setelah menerimanya sejak Se- lasa (25/6). KPS itu selanjutnya dapat digunakan warga miskin untuk mengambil dana Bantuan LangsungSementaraMasyarakat (BLSM) sebagai konsekuensi dari pencabutan subsidi Bahan Bakar Minyak (BBM). Manajer Pemasaran Kantor Pos Tulungagung, Agus Pamuji mengatakan, pihaknya meneri- ma KPS sebanyak 57.215 lembar untuk Tulungagung dan 55.527 lembar untuk Trenggalek. Semua sudah mulai kami distribusikan melalui kantor pos kecamatan, setelah itu berkoordinasi lagi de- ngan perangkat desa untuk mem- bagikan kepada seluruh penerima KPS, kata Agus Pamuji. Meski sudah mendistribusi- kanKPS,pihakkantorposbelum memastikan jadwal pencairan KPS. Namun, jika merujuk jad- wal dari pemerintah pusat, seti- daknya mulai 1 Juli 2013 harus sudah dimulai pencairannya. Bagaimana jika ada yang komplain karena merasa berhak menerima BLSM tetapi tidak masuk data? Agus Pamuji me- nyatakan, penentuan penerima BLSM bukan oleh pihak kantor pos, bukan pula oleh dinas so- sial maupun Badan Pusat Sta- tistik. Setahu Agus Pamuji, pe- nentunya adalah TNP2K (Tim Nasional Percepatan Penanggu- Warga Miskin Kota Kediri Terima Dobel■ banyuwangi, surya - Se- orang anggota DPRD Banyuwa- ngi, TS, menjadi tersangka da- lam kasus kepemilikan narkoba jenis sabu-sabu, Jumat (28/6). Penetapan status tersangka TS setelah polisi menangkap TS di sebuah gudang beras di Desa grogol Kecamatan Giri, Banyu- wangi, Kamis (27/6) sore. TS ditangkap setelah polisi menggerebek tempat tersebut. Dari tangan TS, polisi menyita sabu-sabu seberat 0,33 gram, bong pengisap sabu-sabu dan pipet kaca sumbu. Dari infor- masi yang dihimpun Surya, po- lisi juga menemukan dua koper VCD porno dan beberapa alat bantu seks. Kapolres Banyuwangi AKBP Nanang Masbudi mengatakan, penyidik masih terus mengem- bangkan penangkapan tersebut. Masih dikembangkan, juga ke- mungkinan adanya pelaku lain, ujar Nanang, Jumat (28/6). Dari hasil tes urine, TS positif mengonsumsi sabu-sabu. Dia ditetapkan sebagai tersangka karena dituduh melanggar Un- dang-Undang Nomor 35 Tahun 2009 tengan Narkotika. Sementara itu Ketua DPRD Banyuwangi Hermanto menga- takan pihaknya belum meneri- ma laporan secara resmi tentang penangkapan TS dari partainya yakni Partai Gerindra. Dalam waktu dekat tentunya akan kami bahas. BK (Badan Kehormatan) juga harus segera bekerja, ujar Hermanto. TS merupakan anggota di BK DPRD Banyuwangi. Ia berasal dari Partai Gerindra yang kini juga kembali mencalonkan diri sebagai caleg dari partai terse- but. Hingga kemarin siang, tak ada satu pun baik anggota fraksi maupun pengurus Partai Gerin- dra yang bisa dikonfirmasi. Saat sidang paripurna di gedung DPRD, tak ada anggota Frak- si Gerindra yang hadir. Kantor DPC Partai Gerindra Banyuwa- ngi pun sepi. (uni) surya/yuli ahmada sidang jalanan - Seorang hakim dibantu panitera pengganti menyidangkan para pelanggar peraturan lalu lintas di Tulungagung. Mereka yang terjaring razia, langsung disidangkan di tempat. Politisi Banyuwangi Konsumsi Sabu-sabu Kartu Perlindungan Sosial (KPS) tiba di kantor pos dan mulai didistribusikan Pengambilan BLSM harus menggunakan KPS dilaksanakan paling cepat 1 Juli 2013 Di Kota Kediri warga miskin mendapat BLSM dobel. Selain dari pemerintah pusat, juga mendapat bantuan dari APBD Rp 250.000/bulan ■ ■ ■ storyhighlights surya/sutono beri wejangan - Wagub Saifullah Yusuf ketika memberi wejangan di depan para peserta Perwimanas. Ajak Pramuka Ikut Perangi Narkoba tulungagung, surya - Guna mengantisipasi teroris dan peredaran narkoba, Polres Tulungagung memeriksa selu- ruh pengguna jalan di Jl Raya Pahlawan, Desa Rejoagung, Kedungwaru, depan Taman Makam Pahlawan, Jumat (28/6) pukul 09.00. Anggota Satlantas Polres Tulungagung menghentikan seluruh kendaraan untuk memeriksa kelengkapan surat dan aksesori kendaraan. Bagi pengendara dari luar daerah wajib mengikuti tes urine. Pe- meriksaan ketat dilakukan ke- pada seluruh pengendara mobil angkutan barang. Ini menjalankan instruksi Kapolda Jawa Timur agar be- kerja sama dengan kejaksaan, pengadilan, unit narkoba untuk menggelar operasi bersama, kata Kasatlantas AKP Bobi Adi- mas CP. Operasi ini merupakan rangkaian peringatan Hari Bu- lan Bhakti Pelayanan Prima da- lam rangka HUT Bhayangkara ke-67 dan Hari Anti Narkoba Internasional (HANI) 2013. Menurut dia, sasaran op- perasi adalah mengantisipasi peredaran narkotika, tindak terorisme, dan pencurian ken- daraan bermotor. Sejumlah pe- langgar peraturan lalu lintas, terutama kepemilikan STNK, juga langsung disidang oleh hakim di lokasi razia. Sedang- kan yang tidak membawa SIM (Surat Izin Mengemudi) dian- jurkan mengikuti sidang di pengadilan. Kepala Satuan Reserse dan Narkoba, AKP Sugiarjo, me- nambahkan, tes urine dilaku- kan kepada para pengemudi kendaraan roda empat dari luar Tulungagung. Kalau ada yang mencuriga- kan, langsung kami gelandang untuk tes urine, ujarnya. Namun hingga operasi ber- akhir tidak ditemukan penge- mudi yang terindikasi terlibat terorisme maupun narkoba. Semua pelanggaran yang dite- mukan hanya masalah keleng- kapan kendaraan saja. Dengan adanya sidang di tempat, para pelanggar tidak perlu menung- gu sidang di pengadilan untuk membayar denda. (yul) Pengemudi Luar Kota Wajib Tes Urine Sopir Tetap Pakai Tarif Sendiri Ponpes Al-Amien Peduli Lingkungan jember, surya - Paguyuban sopir angkutan kota (angkot) di Jember sepakat menolak tarif baru yang diusulkan oleh Dinas Perhubungan Jember ke Bupati Jember MZADjalal Rp 3.500. Pa- salnya, mereka bersepakat tarif Kleting Kuning (sebutan untuk angkot) Rp 4.000. MeskipunditetapkanRp3.500 kami menolaknya. Kami tetap akan pakai Rp 4.000, itu kesepa- katan di antara sopir. Apalagi da- lam penentuan tarif, kami tidak dilibatkan, tegas Kustomo, dari paguyuban sopir Kleting Kuning Jember, Jumat (28/6). Ia menambahkan, paguyuban sopir angkot tidak diajak mem- bahas tarif baru setelah kenaikan hargaBBM.Namundiamendapat kabar dishub mengusulkan tarif baru Rp 3.500 kepada bupati. Menurutnya, meskipun sopir menyepakati tarif Rp 4.000, terkadang sopir tidak konsisten menerapkan kesepakatan itu. Ia mencontohkan sejumlah buruh yangterkadanghanyamembayar separo dari tarif yang disepakati. Dulu ketika kami menarik Rp 3.000, tidak sedikit penumpang kategori umum yang memba- yar Rp 1.500 atau Rp 2.000, ujarnya. Penumpang juga membayar separo jika jarak perjalanannya tidak terlalu jauh. Padahal ja- rak jauh atau pendek tarifnya sama. Jadi kalaupun nanti tarif Rp 4.000, mungkin ada juga pe- numpang umum yang mem- bayar kurang dari itu, imbuh- nya. Sebelumnya, Dishub Jember mengaku sudah melakukan ra- pat dengan Organda (Organisa- si Angkutan Darat) untuk tarif baru angkutan darat di Jember. Untuk lin atau angkutan dalam kota diusulkan tarif baru dari Rp 2.250 menjadi Rp 3.500. Namun pada praktiknya, tarif lin telah naik sepihak menjadi Rp 4.000. (uni) sumenep, surya - Pondok Pesantren Modern di Prenduan, Kabupaten Sumenep, menerima penghargaan dari Kementerian Kehutanan sebagai pondok pesantren yang peduli terhadap lingkungan hidup dan program penghijauan yang telah dica- nangkan pemerintah. Menurut Kepala Perum Per- hutani Madura Murgunadi, penghargaan kepada lembaga Pondok Pesantren Al-Amien Prenduan, Sumenep itu diserah- kan oleh Anggodo, Kabid Wi- layah II, mewakili Kepala Balai Besar Konservasi Alam Jawa Ti- mur kepada pengasuh pondok itu KH Maktum Djohari. Ini juga sebagai bentuk langkah nyata yang dilakukan pesantren atas kepeduliannya pada lingkungan, kata Mur- gunadi. Pondok Pesantren Al-Amien merupakan salah satu pondok pesantren di Madura yang sela- ma ini menjadi mitra pemerintah dalam berupaya melestarikan lingkungan dan menekan terja- dinya pemanasan global melalui program penghijauan. Hasil pemantauan yang dila- kukan oleh pihak Kementerian, ternyata program yang dijalan- kan di pesantren itu memang sangat luar biasa, dan itu dibuk- tikan di lingkungan pesantren sendiri, kata Murgunadi. Pondok Pesantren Al-Amien merupakan salah satu Pondok Pesantren di Pulau Madura, yang berada di Desa Prenduan, Kecamatan Pragaan Kabupaten Sumenep, sekitar 30 kilometer ke sebelah barat kota Sumenep. Bangunan pesantren ini di areal seluas 25 hektare yang menye- bar di beberapa lokasi di Desa Pragaan Laok dan Desa Prendu- an. (ant) langan Kemiskinan). Sementara itu, warga Kota Kediri lebih beruntung diban- ding warga di daerah lain, kare- na mereka menerima dua BLSM. Pemkot Kediri juga telah meng- anggarkan dana untuk program serupa, tapi sebagai bantuan un- tuk warga miskin. Nominalnya Rp 250.000 per kepala keluarga (KK), sementara daripemerintahpusatRp150.000 per KK. Jumlah pasti, penerima BLSM dari pemerintah pusat 11.694 KK, sementara dariAPBD Kota Kediri 12.000 KK. Asisten Bidang Pemerintah- an Kota Kediri Budi Siswanto- ro menjelaskan, program BLSM bantuan dari pusat rencananya akan turun awal Juli menda- tang, sementara untuk BLSM bantuan pemkot saat ini hampir tuntas pendistribusiannya. Pemberian BLSM dari APBD itu sempat mendapatkan kritik dari anggota DPRD setempat. Bantuan yang harusnya dibagi- kan di tingkat kelurahan, diberi- kan langsung ke rumah-rumah. anggota Komisi C DPRD Kota Kediri Kholifi Yunon meng- kawatirkan terjadinya penya- lahgunaan anggaran tersebut. Nominal uang yang diberikan cukup besar, yang dikhawatir- kan bisa memicu terjadinya pe- luang digunakan tidak sebagai- mana mestinya. Menurut politisi PAN itu, awalnya penentuan penerima BLSM diambil berdasarkan pen- dataan program perlindungan sosial (PPLS) 2011. Namun, jika ada masalah semisal ada warga yang belum masuk sebagai pe- nerima BLSM, maka diserahkan pada forum kelurahan untuk menyelesaikannya. Di Jember KPS diterima Kan- tor Pos Jember pada Kamis (27/6) malam. KPS yang kami terima 192.951 kartu. Setelah datang kami langsung lakukan verifikasi dan pencocokkan resi penerimaan, kata Kepala Kan- tor Pos besar Jember, Wahyudi Aziz. Petugas Kantor Pos Jember masih melakukan verifikasi. Se- telah selesai, pihak Pos akan ber- koordinasi dengan Pemkab Jem- ber untuk mendistribusikan KPS ke rumah tangga sasaran (RTS). Penerima BLSM ketika menca- irkan harus membawa KPS itu juga disertai kartu identitas. Ini berbeda pada Bantuan Langsung Tunai (BLT) yang menggunakan kupon. (yul/uni/ant) surya/sudarmawan merawat melon - Seorang petani Ponorogo tengah merawat tanaman melonnya. surya/yuli ahmada kartu miskin - Pegawai Kantor Pos Tulungagung menunjukkan Kartu Perlindungan Sosial (KPS) untuk mengambil dana BLSM. join follow @portalsurya
  • 6. HALAMAN | | SABTU, 29 JUNI 2013 Jawa Timur | u saha Suparno di Du- sun Kwatangan, Desa Ringinagung, Kecamat- an/Kabupaten Magetan, tak bisa dipandang sebelah mata. Produknya sudah menembus pasar manca negara. Usaha yang awalnyadijualkelilingdanmangkal di tempat wisata Sarangan in,i kini dalam sebulan bisa meraup omzet hinggaRp90juta-Rp100juta. Kalau usaha lain ada masa-masa subur masa kering, sepanjang saya menekuni usaha kerajinan anyaman bambu ini, merasakan hampir tidak ada masa peceklik itu, kata Supar- no. Kenaikan harga BBM juga tak mempengaruhi pemasaran, meski upah angkutan naik sedikit. Suparno kini mempe- kerjakan 60 orang yang rata- rata usia antara 20 tahun - 25 tahun. Mereka sebagai pekerja kreatif yang menangani desain anyaman bambu itu. Anyaman bambu yang diproduksi perusahaan Bambu Murni milik Suparno berupa keranjang parsel berbagai ukur- an, tempat koran, kap lampu berbagai model, tutup saji, kotak tisu, kotak perhiasan dan masih banyak jenis yang hanya diproduksi sesuai pesanan. Saya memulai usaha kerajin- an anyaman bambu ini tahun 1983. Saat itu berbagai model anyaman bambu saya bawa dengan dipikul ke tempat wisa- ta Sarangan, kenang Suparno yang benar-benar meniti usaha- nya dari bawah. Di Sarangan akhirnya dia me- nemukan pembeli dari berbagai daerah. Mereka memesan da- gangan Suparno untuk dikirim ke daerah mereka. Sejak saat itu, Suparno mulai memasuki era penjualan partai, bukan lagi hanya melayani pembeli eceran. Anyaman bambu Suparno pun kemudian merambah hingga ke Bandung, Surabaya, Yogyakarta, Jakarta, dan Bali. Malahan kerajinan anyaman bambu desain pemu- da-pemudi Dusun Kwatangan itu sudah sampai Malaysia dan Singapura. Ayaman bambu Suparno bisa menembus hingga ke Malaysia dan Singapura melalui eksportir di Jakarta. Katanya merupa- kan pesanan hotel dan super market, tutur pria yang kelima anaknya kini sudah sarjana dan hampir seluruhnya bekerja di luar Magetan ini. Anyaman bambu seperti ini sebenarnya banyak yang membuat. Hampir di berbagai daerah bis ditemukan. Na- mun anyaman bambu buatan Suparno mempunyai keung- gulan. Yakni lebih murah, serta lebih halus dan tahan lama dari kelapukan. Makanya hotel-hotel di Yogyakarta, Bandung, Jakarta, dan Bali lebih memilih kap lam- pu dan keranjang parsel dari Magetan karena lebih halus dan kualitas lebih tahan lama diban- dingkan produk setempat, kata Suparno. Pesanan selalu rutin datang sepanjang tahun. Karena itu, Suparno boleh berbangga dengan mengatakan, tidak ada kata paceklik bagi usaha- nya. Masa sepi pasar untuk kerajinan anyaman bambu ini hampir tidak ada. Sepanjang ta- hun, pesanan terus meningkat. Kalau pesanan menurun jarang, bahkan tidak pernah. Kalau terus bertambah setiap bulan, bisa,ujar Suparno. Apalagi menjelang puasa dan lebaran, pesanan dari berbagai kota besar mulai berdatangan. Begitu juga pesanan dari peda- gang dari berbagai daerah wisa- ta seperti dari Jakarta, Bandung, Yogyakarta, dan Bali. Malah kini para pedagang ada yang sudah memberi uang muka. Ini dilakukan agar bisa terima barang lebih cepat. Tapi perusahaan ini tidak pandang uang muka, antrean yang kami sepakati dan itu berusaha kami tepati, tambah Suparno. Perusahaan Bambu Murni juga memberikan lapangan pekerjaan bagi warga desa se- tempat dan sekitarnya. Mereka direkrut Suparno sebagai pera- jin. Kendati demikian, Suparno belum pernah merasakan ban- tuan dari Pemkab Magetan. Sesungguhnya dia mengha- rap ada bantuan modal kerja. Dia butuh modal untuk me- remajakan mobil yang dipa- kai untuk pengiriman ke luar daerah. Mobil yang dia miliki keluaran tahun 1980-an, dan kapasitas muatnya terbatas. Saya berharap Pemkab Magetan bisa memberi pin- jaman lunak berupa uang atau langsung kendaraan, harap- nya. Suparno juga berharap bisa membeli mesin pengering. (doni prasetyo) Nikah Massal Tidak Tepat Sasaran jember, surya - Anggaran untuk nikah massal Rp 1,3 mili- ar dari APBD Kabupaten Jember sia-sia, lantaran kegiatan itu di- nilai tidak tepat sasaran. Seharusnyanikahmassalditu- jukan kepada pasangan tua yang telah berumahtangga, namun belum mencatatkan pernikahan mereka di Kantor Urusan Aga- ma (KUA). Mereka dinikahkan dengan biaya pemkab. Namun dalam nikah massal yang belum lama ini digelar kantor Dinas Kependudukan dan Catatan Sipil (Dispendukca- pil) Jember, terdapat pasangan muda yang baru menikah. Komisi A DPRD dan Komisi D DPRD Jember serta Lembaga Swadaya Masyarakat (LSM) Saur Sepuh ikut heran dengan acara tersebut. Padahal anggaran un- tuk sidang istbat nikah (memper- barui nikah) mereka yang meni- kah siri atau menikah di bawah tangan, bukan orang yang baru menikah alias nikah massal gra- tis, ujar Koordinator LSM Saur Sepuh Bambang Irawan. Terpisah, Ketua Komisi A, M Jufriyadi mengatakan, anggar- an Rp 1,3 miliar yang disetujui oleh DPRD Jember seharusnya digunakan untuk istbat nikah, bukan untuk menikahkan pa- Orang lain boleh mengeluh tentang usahanya yang bertanbah seret akibat kenaikan harga BBM. Namun bagi Suparno, pengusaha kerajinan anyaman bambu di Magetan, tidak ada kata paceklik dan selalu menatap masa depan dengan penuh optimistis. Kerajinan Anyaman Bambu Magetan Sepanjang Tahun Tidak Kenal Masa Paceklik madiun, surya - Sejum- lah barang kebutuhan pokok terus merangkak naik. Selain karena efek domino dari ke- naikan BBM, juga karena men- jelang puasa yang jatuh pada tanggal 9 Juli 2013 nanti. Pantauan di sejumlah pasar tradisional di Kota Madiun, hargacabainaikdariRp40.000/ kg pada pekan lalu, menjadi Rp 46.000/kg. Bawang merah naik dari Rp 22.000/kg menjadi Rp 25.000/kg, bawang putih naik dari Rp 9.000/kg menjadi Rp 10.000/kg, tomat dari Rp 6.000/kg menjadi Rp 7.000/kg, dan telur dari Rp 16.000/kg kini menjadi Rp 18.000/kg. Sedang harga beras varietas IR 64 dari Rp 7.500/kg menjadi Rp 7.900/kg. Hargabumbu-bumbuanme- mang sudah naik sejak keharga BBM naik. Kalau harga cabai, tomat, bawang dan lainnya, itu karena faktor cuaca yang masih sering hujan. Jadi produksinya sedikit, sedangkan permintaa- nya banyak. Apalagi menjelang puasa, kata Ujang Soleh, peda- gang Pasar Besar Madiun. Harga sayur-mayur pun juga ikut merangkak naik. Rata-rata naik paling sedikit Rp 1.000 setiap kg. Seperti wortel naik dari Rp 6.500/kg menjadi Rp 7.500/kg. Buncis naik dari Rp 5.500/kg menja- di Rp 6.500/kg, kentang naik dari Rp 7.500/kg menjadi Rp 8.500/kg, dan tomat naik dari Rp 6.000/kg menjadi Rp 8.000/kg. Kata pemasok karena ong- kos angkutnya naik, kata Yono salah satu pedagang di Pasar Besar Madiun. Harga ini diperkirakan naik lagi karena menjelang bulan puasa. Para pedagang mengaku tidak ter- lalu khawatir dengan harga yang naik, mereka hanya ka- watir pembeli tidak mampu sehingga pasar menjadi sepi. Dinas Perindustrian, Per- dagangan, Koperasi dan Pa- riwisata (Disperindagkoppar) Kota Madiun mengakui kena- ikan harga beberapa bahan. Dari hasil pemantauan kami di lapangan memang ada beberapa komoditi yang meng- alami kenaikan. Kenaikan itu dipicu oleh biaya transportasi, ujar Kepala Bidang Perdagang- an Disperindagkoppar Kota Madiun, Heri Wasana. Namun ketersediaan bahan mencukupi menjelang puasa. (bet) surya/imam hidayat semua naik - Seorang penjual bahan makanan di Pasar Besar Madiun. Harga semua bahan makanan dan bahan pokok naik akibat dipicu kenaikan harga BBM dan menjelang puasa. Harga Terkerek BBM dan Jelang Puasa Stok Bahan Mencukupi■ surya/doni prasetyo pekerja kreatif - Warga Desa Ringinagung yang dipekerjakan Suparno sebagai pekerja kreatif. Ada Pasangan Baru Ikut Dinikahkan■ Nikah massal diikuti 93 pasangan sebagian di antaranya ternyata pasangan baru Komisi A dan D menganggap anggaran Rp 1,3 miliar untuk nikah massal tidak tepat sasaran Pengadilan Agama mengaku tidak dilibatkan ■ ■ ■ storyhighlights SUMENEP, surya - Belum sebulan ka- sus pembunuhan dengan tudingan ilmu santet yang menimpa warga Kecamatan Batang Batang, kasus serupa kembali ter- jadi. Korban adalah Misjawi (58) warga Dusun Bata Tengah, Desa Beluk Kenek, Kecamatan Ambunten, Sumenep. Lelaki yang dituduh mengamalkan ilmu hitam itu, dihabisi sekelompok orang bercadar di kamar tidurnya pada Jumat (28/6) dini hari. Masriyah (49), istri korban yang saat itu tidur bersamanya mengatakan, pela- kunya tiga orang yang semuanya mema- kai jaket hitam dan menutup wajahnya dengan cadar. Masriyah dini hari itu terbangun ketika pintu rumahnya didobrak para pelaku. Ketiganya langsung menuju ke suaminya yang masih terlelap, dan tanpa banyak bicara langsung mengayunkan celurit mereka ke tubuh suaminya. Masriyah meminta ampun agar suami- nya tidak dibunuh. Tetapi permohonan- nya tidak digubris oleh para pelaku. Ma- lah kepala perempuan itu juga dipukul celurit. Setelah yakin korban tak bernya- wa lagi, ketiga pelaku kemudian kabur lewat pintu yang mereka dobrak ketika masuk. Kapolsek Ambunten, Iptu Supardi sa- sat dimintai keterangan mengatakan, pe- laku diperkirakan tiga orang dan masuk lewat pintu dengan cara mendobrak pin- tu. Setelah puas melakukan aksinya, dua orang pelaku lari ke arah timur, semen- tara satu pelaku lari ke arah barat lewat gang di samping rumah korban. Kini kami masih menggelar olah TKP (tempat kejadian perkara) dan meminta keterangan keluarga korban, termasuk juga saksi-saksi lain yang diperkirakan mengetahui kasus pembunuhan ini,’’ tan- das Supardi. Tentang motif, Supardi mengaku ma- sih belum mengetahui secara pasti di- balik pembunuhan sadis itu. Karena itu, pihaknya perlu waktu untuk mengung- kapnya dan akan diketahui nanti setelah hasil akhir pemeriksaan dan keterangan dari sejumlah saksi. Namun desas-desus yang berkembang di masyarakat, korban mempunyai ilmu santet. Dia kerapkali dituduh sebagai yang bertanggungjawab atas kematian warga yang dianggap tidak wajar. Pada Selasa (6/6) Yakub alias P Santo- so (49), warga Dusun Rongkeyang Barat, Desa Nyabakan Timur, Kecamatan Ba- tang Batang, Sumenep, tewas dibantai pelaku tidak dikenal diduga karena isu tuduhan sebagai dukun santet. Petani pengambil air nira ini ditemukan warga setempat tewas di sawah. Kasus serupa juga menimpa Subahral (70), warga Desa Juruan Laok, Kecamatan Batuputih, Kabupaten Sumenep. Lima pe- lakunya berhasil ditangkap polisi. (riv) Curigai Sejumlah Orang bangkalan - Polres Bangkal- an hingga sepekan ini belum me- netapkan seorang tersangka pun dalam kasus pembobolan brankas SMAN 3 Bangkalan yang terjadi pada Jumat (21/6). Pemeriksaan terhadap saksi-saksi terus berjalan. Namun belum bisa mengarah pada tersangka, ungkap Kapolres Bangkalan AKBP Soelistijono, Ju- mat (28/6). Kendati demikian, lan- jutnya, polres telah mengantongi beberapa nama yang dicurigai terlibat dalam kasus yang merugi- kan sekolah sebesar Rp 375 juta itu. Ada sejumlah orang yang kami curigai, tapi kami tidak bisa me- nyebutkan. Orang luar atau orang dalam, ini masih kami kembangkan, jelasnya. Seperti diketahui, pencuri berhasil menguras isi brankas SMAN 3 Bangkalan Rp 375 juta. Uang itu disiapkan untuk gaji guru dan kepentingan sekolah lainnya. (st32) Razia Temukan SIM Palsu TULUNGAGUNG - Anggota Satlantas Polres Tulungagung menemukan SIM (Surat Izin Mengemudi) palsu saat menggelar operasi di depan Taman Maham Pahlawan, Jumat (28/6). SIM jenis B1 tersebut atas nama Surani (43), warga Kota Kediri, pe- ngemudi truk yang memuat ayam. SIM-nya mencurigakan, dan ketika dicek di Kediri, namanya berbeda. Pemilik SIM beserta SIM-nya kami amankan, kata Kasatlantas Polres Tulungagung, AKP Bobi Adimas Cp. Awalnya, polisi curiga kondisi SIM yang sudah terkelupas jadi tiga bagian, padahal pembuatan SIM itu belum lama. Meski sudah yakin secara visual SIM itu palsu dan dikuatkan dengan hasil pengecekan ke Kediri, polisi masih me- rasa perlu untuk menguji di laboratorium. (yul) LINTAS JAWA TIMUR surya/rivai dampingi suami - Masriyah mendampingi jenasah suaminya dibawa ke rumah sakit di dalam mobil jenasah. sangan baru. Pengertian kami begitu, tetapi kok kenyataanya berbeda sama yang di lapangan. Kami takutnya anggaran itu tidak tepat sasaran, ujar Ketua Komisi D, Ayub Junai- di yang juga mengaku heran. Pada Jumat (28/6), komisi A dan D bertemu dengan LSM Saur Sepuh dan mendengarkan persoalan dan temuan mereka. Sayangnya, pihak Dispenduk- capil tidak hadir. Menurut kete- rangan anggota Komisi AAbdul Halim, Kepala Dispendukca- pil Isman Sutomo ada acara ke luar kota yakni rapat koordina- si pencatatan kependudukan di Malang. Sementara itu, Pengadilan Agama (PA) Jember mengaku belum pernah dilibatkan dalam acara sidang istbat nikah yang dilakukan instansi lain selain PA Jember sendiri. Menurut Hu- mas PA Jember Khamimudin, di tahun 2013, PA Jember sudah menggelar dua kali sidang istbat, yakni di Kecamatan Ledokombo dan Sumberjambe. PA melakukan sidang istbat sendiri, karena ada anggaran dari APBN untuk itu, ujar Kha- mimudin. Pihaknya juga tidak pernah dilibatkan dalam agenda istbat nikah yang digelar oleh Pemkab Jember. Ia mengakui pemkab pernah berkoordinasi terkait rencana istbat nikah untuk 1.000 pasang- an muslim dan 200 pasangan nonmuslim. Namun hingga kini tidak ada lagi kabar tentang ist- bat nikah dan perbaruan nikah tersebut. Nikah massal digelar pada Pada Rabu (19/6) diikuti 93 pasangan di pendapa Kabu- paten Jember. Mereka berasal dari 31 kecamatan se-Kabu- paten Jember. Tidak sedikit di antara peserta nikah massal itu yang ternyata pasangan baru, sehingga menimbulkan tanda tanya. (uni) Tiga 'Ninja' Habisi Korban di Tempat Tidur Vandalisme yang dilakukan tangan jahil menimpa gambar dan baliho para calon wali Kota Kediri. Perusakan gambar peraga cawali ini ditemukan merata di hampir semua kelurahan. Perusakan gambar ini juga terjadi merata mulai disobek bagian bawah sampai disobek tepat bagian gambar wajah pasangan calon. (dim) gambar cawali dirusak surya/didik mashudi surya/st32 AKBP Soelistijono join follow @portalsurya
  • 7. | SURYALINES| SABTU, 29 JUNI 2013 narasumber di salah satu stasiun televisi swasta. Prof Thamrin tampil sebagai panelis bersama Munarman. Dialog berlangsung di Gedung Nusantara, dan disi- arkan langsung. Kepala Biro Penerangan Ma- syarakat (Karo Penmas) Polri Brigjen Boy Rafli Amar ikut se- bagai panelis, namun dia tidak hadir ke studio, melainkan ber- bicaralewatsambungantelepon. Acara dialog pagi ini khusus membicarakan sikap Polri yang melarang ormas men-sweeping atau merazia tempat hiburan malam selama bulan Ramadan. Thamrin kepada TRIBUN- menuturkan, pe- nyiraman berawal ketika ia menyinggung award kenega- rawanan yang diterima Presi- den SBY dari World Statesman Award, lembaga nirlaba di Amerika Serikat. Thamrin men- jelaskan, penghargaan itu harus dijadikan pijakan bagi negara untuk melindungi siapa pun. Negara harus selalu hadir me- lindungi warga negara. Prof Thamrin menjelaskan, Munarman dalam acara itu sepertinya tidak senang kalau award SBY itu masuk dalam pembicaraan. Padahal, dalam acara itu ia sama sekali tidak menyebut ormas berbasis aga- ma, termasuk FPI. Saya tidak memakai kata ormas, saya menyebut warga masyarakat secara netral tanpa menyebut satu pihak mana pun, jelas Prof Thamrin, yang lahir di Galala, Halmahera Uta- ra, 17 April 1947. Munarman, menurut Prof Thamrin, menganggap dirinya membuat nalisis ngawur. Per- debatan kemudian terjadi. Prof Thamrin memaparkan, Mun- arman mempertanyakan apa hubungan penghargaan yang diterima Presiden SBY, yang kemudian ia jawab itu dapat dikaitkan dengan kehadiran ne- gara dalam melindungi warga. Dalam acara itu, kata Prof Thamrin, analisis yang ia kemu- kakan selalu dianggap menyu- dutkan. Namun, ia menegaskan sama sekali tidak menyebut ormas mana pun. Tapi, hal tak mengenakkan kemudian terjadi, Munarman menyiram air ke wa- jah Profesor Thamrin. Dia siram air yang baru dia minum ke saya. Saya diam dan tak mau membalas apa pun. Tapi, saya tetap memberikan argumen saya, ujar Thamrin. Dialog dipandu Winny Charita dan Arif Fadil itu pun seketika tegang. Arif mencoba menenangkan Munarman yang masih emosi, sedangkan Tham- rin hanya diam melihat tingkah laku lawan bicaranya. Dialog itu pun akhirnya dihentikan. Berbagai pihak meminta Thamrin untuk melaporkan tindakan Munarman ke polisi. Namun Thamrin menolak. Ia beralasan biar masyarakat saja yang menghukum secara sosial atas tindakan Munarman. Untuk apa saya layani (lapor polisi. Orang seperti Munarman tidak level, hukuman publik akan jatuh kepadanya. Walau- pun saya secara fisik diserang dengan air, sebenarnya secara publik dia menghinakan diri sendiri, kata Thamrin. Usai jeda komersial, presenter Winny Charita dan Arif Fadil meminta maaf atas ketegangan itu. Prof Thamrin memastikan, ia tidak akan melaporkan Mun- arman ke Polri atas kejadian ini. Ia hanya meminta Polri bertin- dak atas kejadian itu. Tolak Minta Maaf Sementara itu, saat dikon- firmasi mengenai hal ini, Munarman mengakui telah menyiramkan air dalam gelas ke wajah Profesor Thamrin. Walau demikian, dia tidak menyesali dan menyatakan siap meladeni jika masalah dibawa ke jalur hukum. Ia juga tidak akan me- minta maaf. Munarman me- ngatakan, ia jengkel atas sikap Thamrin yang sering memotong argumennya ketika bicara. Saya memang melakukan itu karena argumentasinya sudah di luar konteks. Saya anggap dia itu intelektual sampah, kata Munarman saat dimintai tang- gapan oleh, kemarin. Munarman mengatakan ia akan mempertanggungjawabkan tindakannya. Saya akan ladeni dia, saya tidak takut. Karena da- lam diskusi itu, argumentasinya ngawur. Biar dia itu ngomongnya lebih sopan. Itu pelajaran buat dia, ujar Munarman. Meski perbuatannya banyak mendapat kecaman, Munarman mengaku tidak menyesali per- buatannya. Jalur Hukum Kepala Biro Penerangan Ma- syarakat Brigjen Pol Boy Rafli Amar yang juga menjadi pem- bicara dalam acara itu berharap peristiwa itu tak berbuntut panjang. Saya berharap itu ha- nya miskomunikasi saja. Untuk beliau beliau yang saya hormati semoga bisa menyelesaikan hal ini secara damai, kata Boy di Mabes Polri, Jakarta Selatan, kemarin siang. Boy yakin kedua tokoh itu tidak akan menempuh jalur hukum dan akan saling me- maafkan. Kami yakin sebagai sesama bangsa ini harus saling hormat-menghormati, hidup rukun, dan saling maaf-mema- afkan, katanya. Tetapi, bila Thamrin merasa ingin menyelesaikan tindakan Munarman di jalur hukum dengan melapor ke pihak ke- polisian, hal itu merupakan hak hukum yang dimiliki seorang masyarakat. Semua hak hukum masyara- kat itu harus kita terima. Hak se- tiap masyarakat dijamin undang undang, bila merasa dirugikan, bisa menyampaikan kepada apa- rat terkait bila ada hal hal yang berkaitan dengan hukum, ung- kapnya. (tribunnews/yat/adi) perintah pimpinan. Dicopot dari jabatan saya, saya siap, ucap Eko usai turun dari tangga masjid. Kapolres juga meminta kepa- da semua anggota agar tetap menjalankan tugasnya dengan baik. Eko juga meminta kepada seluruh jajarannya menerima pencoptoan atas dirinya sebagai realita dalam tugas. Kami berharap agar semua anggota tidak larut dalam masalah ini. Nantinya siapa pun pengganti saya, saya yakin semua anggota tidak terdam- pak. Semua akan berjalan dengan baik, kata Eko. Meski demikian, kapolres ini enggan mereaksi putusan Polda yang menyatakan dirinya melakukan tindakan yang tidak patut dilakukan selaku pim- pinan terhadap anak buahnya. Termasuk tuduhan pelecehan seksual dalam pengukuran seragam Briptu Rani. Tuduhan ini dilakukan saat polwan cantik ini menjadi ajudan Eko beberapa waktu lalu. Soal kebenaran pelecehan dan seluruh materi tuduhan itu, ada baiknya tanyakan ke Polda. Saya tidak berhak menja- wabnya. Ini demi objektivitas persoalan, pinta Eko. Eko mengaku saat ini tengah berpikir mengenai keluarganya pascaputusan Polda mencopot dirinya atas kasus Briptu Rani. Eko menuturkan bahwa keluarganya menerima dengan lapang dada. Alhamdulillah, insyaallah keluarga tidak ada masalah. Mudah-mudahan ini menjadi pelajaran kita semua. Tak hanya saya. Saya yakin semua ada hikmahnya, tutur Eko. Soal siapa penggantinya sebagai Kapolres Mojokerto,Eko mengatakan semuanya menunggu perintah atasan. Siapa peng- ganti saya,tunggu TR-nya nanti bagaimana. Semua sudah ada mekanismenya, katanya. Rani adalah anggota Polres Mojokerto yang dikenal sebagai polwan cantik. Sebelumnya, perempuan asal Bandung ini adalah anggota Polwil Bojonegoro. Karena dibekukan lembaga ini, Briptu Rani pindah ke Mojokerto. Pernah bertugas di satuan Lantas. Kemudian ke bagian Perencanaan hingga terakhir ditarik menjadi ajudan Kapolres Eko Puji Nugroho. (fai) yang gagal dalam tendangan pe- nalti adalah Leonardo Bonucci. Kini Tim Matador berkesempat- anmemenangigelaranPialaKonfe- derasiuntukkalipertama,sekaligus melanjutkan dominasinya setelah memenangi Euro 2008, Piala Dunia 2010,danEuro2012. NamunPelatihSpanyolVicente del Bosque menilai Brasil lebih fa- vorit menjuarai Piala Konfederasi 2013. Brasil lebih favorit. Mereka pernah menjuarai Piala Dunia dan Piala Konfederasi tiga kali. Kami akan menghadapi mereka di Maracana dan kami senang melakukannya, kata Del Bosque. Selainsebagaituanrumah,kon- disi fisik para pemain Tim Samba dinilai lebih fresh. Brasil lebih dulu ke final, setelah sehari sebe- lumnya mengalahkan Uruguay 2-1. Itu artinya mereka lebih lama istirahat dibanding para pemain Spanyol yang tenaganya terkuras untuk bermain 120 menit. Namun Del Bosque berharap kondisi pe- mainnya cepat pulih. Kami ingin memulihkan kondisi dan tampil dalam kon- disi terbaik. Dalam tiga hari ke depan, kami akan mencoba me- lakukannya. Spanyol bermain 120 menit malam ini. Pemain kami sudah biasa tampil dua kali dalam sepekan. Maka, kami yakin akan tampil maksimal pada Minggu nanti, lanjutnya. Kami tak tahu siapa yang akan mendominasi dan memiliki pe- nguasaan bola lebih banyak pada pertandingan final nanti. Kami akan mencoba mendominasi. Malam ini, Italia sangat kuat dan mereka mengontrol pertanding- an, tambah Del Bosque. Selain itu, Brasil dinilai pelatih yang sukses membawa Spanyol menjuarai Piala Dunia dan Piala Eropa itu memiliki pemain yang lengkap. Akan menjadi sebuah kesalahan jika timnya hanya terfokus pada beberapa orang. Dani Alves dan Marcelo pemain hebat. Mereka mampu memengaruhi pertandingan. Ne- ymar fantastis dan lini tengah me- reka juga sangat fantastis. Maka, kami tak bisa membicarakan ten- tang satu atau dua pemain Brasil saja untuk diantisipasi, ulasnya. Kelelahan yang dialami pa- sukan Matador diakui oleh Kap- ten Iker Casillas. Apalagi cuaca di Brasil yang panas membuat para pemain Spanyol cepat me- rasakan lelah saat pertandingan. Kami memang sangat lelah, kami butuh istirahat. Tetapi kami harus menghadapi Brasil di Maracana. Saya pikir mereka tidak akan sama dengan Italia. Kami akan memainkan per- tandingan yang menarik, ujar pemain Real Madrid ini. Gairah Brasil untuk menjua- rai Piala Konfederasi memang sangat besar. Brasil akan meno- rehkan rekor seandainya tampil sebagai juara. Selecao akan men- jadi tim pertama yang tiga kali berturut-turut sukses menjuarai Piala Konfederasi. Bertemunya Brasil dengan Spanyol di partai final juga se- suai dengan harapan mayoritas para pemain Brasil. Mereka pe- nasaran ingin menumbangkan rekor belum terkalahkan Spa- nyol yang sudah lama tertahan. Kami lebih memilih melawan Brasil, kata gelandang Brasil Hernanes. Hernanes lalu menjelaskan posisi Brasil yang semakin hari semakin membaik. Brasil melaju ke babak final Piala Konfederasi 2013 dengan rekor 100 persen menang. Hernanes menyebut keberhasilan Selecao itu dise- babkan karena kecemerlangan Pelatih Luiz Felipe Scolari. Kami sedang dalam periode bagus bersama Scolari, karena sejak dia datang pada Januari atau Februari lalu, dia selalu berkata kami harus berkembang dan terus berkembang, ujar pe- main Lazio ini. Dan kita bisa lihat hasilnya. Kami seperti sebuah tim yang sedang dalam proses pendewa- saan. Kami semua dapat menik- mati bekerja sama dengannya, imbuhnya. Brasil akan mengejar hattrick sekaligus gelar keempat di Piala Konfederasi, sementara Spanyol mengincar gelar pertamanya. Well, duel final ideal di Maracana pun menjadi pertarungan sengit. ( muka) sejak pertengahan 2012. Untuk KPA di atas 70, pada Mei 2013 tumbuh 63,96 persen, melambat dibandingkan per- tumbuhan akhir 2012 yang terca- tat 98,93 persen. Demikian pula, kredit kendaraan roda empat menurun, dari 31,20 persen pada Desember 2012 menjadi 19,99 persen pada Mei 2012. Secara keseluruhan, penya- luran kredit oleh bank-bank umum di Jatim hingga akhir Mei 2013, tumbuh 26,12 persen dengan nominal Rp 253,65 trili- un, papar Junanto Herdiawan. Menyinggung kredit berma- salah (Non-Performing Loan/ NPL) meningkat dari 2,21 per- sen pada April 2013, menjadi 2,22 persen pada Mei 2013. Kepala Penjualan Kredit Konsumer BCA Surabaya, Ririen Amilia Handayani me- ngatakan, bahwa perlambatan KPR karena kebijakan pemba- tasan uang muka hanya terasa di awal. Beberapa bulan sesu- dahnya, pertumbuhan kembali normal. Sempat mengerem di awal, bebernya kepada Surya. Di Surabaya, hingga Mei 2013 KPR BCA mencapai Rp 1,8 triliun atau meningkat se- kitar Rp 1 triliun dibandingkan periode yang sama di tahun sebelumnya. Di PT Bank Negara Indo- nesia (Persero) Tbk kantor wilayah Surabaya, melambat- nya pertumbuhan KPR akibat kebijakan Bank Indonesia (BI) memang terjadi. Hanya saja berlaku untuk KPR di kawas- an-kawasan luar Surabaya. “Di Surabaya, masih banyak orang yang membeli rumah dengan tipe di atas 70, untuk keperluan investasi sehingga dampaknya tidak begitu terasa. Beda dengan kota-kota lain seperti Kediri, pelambatannya sangat terasa,” kata Ryanto Wisnuardhy, Pemimpin Bidang Consumer dan Ritel BNI Kan- wil Surabaya. BNI mencatat KPR di Jatim hingga akhir Mei 2013, sekitar Rp 600 miliar, lebih besar dari KPR yang mereka kucurkan pada periode yang sama di ta- hun sebelumnya. Hingga akhir 2013, bank BUMN ini mematok target Rp 5,5 triliun hingga Rp 6 triliun atau lebih besar dari KPR tahun lalu, Rp 3,4 triliun. (ben) dari sejumlah petugas provos Polda Jatim. Sejumlah warta- wan yang sejak pagi menunggu, juga dilarang meliput sidang ini. Bahkan, petugas membatasi wartawan hanya boleh naik sampai di lantai dua gedung ini. Sidang KKEP yang dipimpin oleh Kabid Propam Polda Jatim Kombes Pol Tomsi Tohir tersebut terkait sejumlah pelanggaran di- siplin yang dilakukan oleh Brip- tu Rani selama menjadi anggota polisi di Polres Mojokerto. Usai sidang, Tomsi Tohir me- nyampaikan bahwa sidang telah mengambil keputusan terhadap Briptu Rani. ”Sidang sudah selesai dan sudah ada keputus- annya. Namun, lebih jelasnya nanti akan disampaikan Kabid Humas (AKBP Awi Setiyono),” jawab Tomsi Tohir. Sayangnya, Kabid Humas Polda Jatim AKBP Awi Setiyono saathendakdikonfirmasisedang dirilis awal Juni 2013. “Sejak dirilis awal Juni 2013, album Kompilasi X Factor Indo- nesia begitu menarik perhatian publik penggemar X Factor dan penikmat musik Indone- sia,” kata Sundari Mardjuki, Marketing Communication Manager Sony Music Entertain- ment Indonesia, Jumat (28/6). Belum sebulan, album itu laku lebih dari 200.000 kopi dan mendapatkan plakat Double Platinum. Album itu antara lain berisi Aku Memilih Setia yang menjadi lagu kemenangan Fatin Shidqia di season pertama X Factor Indonesia, Sampai Habis Air Mataku dari Novita Dewi, dan lagu Luka Di Hatimu dari Nu Dimension. Album yang belum sempat di-launching itu akhirnya resmi diluncurkan. “Konser Super X juga menjadi acara launching album Kompilasi X Factor Indonesia,” tambahnya. Meski tahu bahwa album perdananya menarik minat banyak orang, keseharian Fatin nyaris tidak berubah. Ia tetap remaja yang tengah menikmati kehidupannya. Fatin memahami bahwa segalanya tidak lagi sama seperti sebelum menjadi jawara X Factor. Akan tetapi, ia tidak mengambil pilih- an homeschooling hanya karena alasan sibuk menyanyi meski beberapa kali harus minta izin dari sekolahnya di SMA Negeri 97 Jagakarsa, Jakarta Selatan. “Aku masih ingin sekolah normal, ngerasain perpisahan kelas tiga,” ujarnya beberapa waktu lalu. Ia masih ingin berkumpul bersama teman- temannya. Penampilan Fathin, dukung- an dari Fatinistic, dan single yang langsung laris, menjadi hadiah baginya. Itu sekaligus hadiah kenaikan kelasnya ke- marin. (nva/inc) uang tebusan sebesar Rp 17 juta untuk ijazah tersebut. Sedangkan Sugiyanto, yang termasuk dalam keluarga miskin, tidak memiliki biaya untuk menebusnya. Sugiyanto bahkan sempat menawarkan ginjalnya di Bundaran Hotel Indonesia (HI), Jakarta. Sehari sebelumnya, Men- dikbud Mohammad Nuh sendiri menilai tidak masuk akal jika ada orang tua yang menjual organ ginjalnya untuk menebus ijazah anaknya. Dia berpendapat bahwa seharusnya pendidikan hingga tingkat sekolah tingkat menengah sudah tidak ada beban biaya. Rasanya tidak masuk akal, tapi kalau ada kasus seperti itu, kita akan selesaikan, kata M Nuh saat ditemui di Istana Merdeka, Kamis (27/6). Ia juga menyatakan, sekolah seharusnya tidak boleh mena- han ijazah siswa. Kementerian mengklaim pada saat ini sudah menugaskan anggotanya untuk mencari alamat keluarga yang mendapat masalah biaya tersebut. Ia juga akan melaku- kan evaluasi terhadap sekolah bila benar menahan ijazah siswa. Sarah menimba ilmu di pondok pesantren tersebut sejak 2005 hingga 2012. Akan tetapi, tahun lalu ia ti- dak dapat mengambil ijazah karena masih ada tunggakan biaya ijazah SMP dan SMA sebesar Rp 17 juta. Seperti itu kita harus bantu, pasti kita cari dan selesaikan, kata Nuh. Secara terpisah, Gubernur DKI Jakarta Jokowi mengaku belum tahu ada warga DKI yang menjual ginjal untuk menebus ijazah sekolah di Bogor, Jawa Barat. Namun, jika benar ia kesusahan menebus ijazah anaknya, tidak ada salahnya ia menemui gubernur. Saya enggak tahu. Suruh ke saya saja langsung, ujarnya usai melantik 415 pejabat eselon III di Balai Kota DKI Jakarta. (tem/tribunnews) Kapolres Eko... DARI HALAMAN 1■ Serapan Rumah... DARI HALAMAN 1■ Langsung Double... DARI HALAMAN 1■ Istri Profesor... DARI HALAMAN 1■ Pelatih Spanyol... DARI HALAMAN 1■ Polwan Cantik... DARI HALAMAN 1■ Ijazah Ditebus... DARI HALAMAN 1■ tidak berada di kantor. Melalui ponselnya, mantan Wadir Lan- tas Polda Jatim ini berjanji akan membeber semua terkait hasil sidang tersebut, Sabtu (29/6) hari ini. Tunggakan 3 Hukuman Sebelumnya, AKBP Awi Se- tiyono menyampaikan bahwa Briptu Rani masih punya tung- gakan lebih dari tiga kali SKHD (Surat Keputusan Hukum Disiplin). Bahkan, sebelum de- sersi (mangkir dari kedinasan) sekitar empat bulan lalu, Briptu Rani juga sempat dijatuhi vonis hukuman selama 21 hari ditem- patkan di sel khusus. Hukuman itu belum sempat dijalani sama sekali, sampai Rani menghilang sekitar empat bulan lalu. Polisi berparas can- tik itupun sempat ditetapkan sebagai DPO (Daftar Pencarian Orang) alias buron, setelah lebih dari satu bulan desersi. Dan tiba-tiba, kabar tentang Rani banyak menghiasi media massa. Rani dan keluarganya melapor ke Mabes Polri terkait dugaan kasus pelecehan yang telah dilakukan oleh pimpinan- nya, Kapolres Mojokerto AKBP Eko Puji Nugroho. Keluarga Briptu Rani menya- takan bahwa Rani menghilang karena depresi akibat Kapol- res Mojokerto AKBP Eko Puji Nugroho telah berbuat asusila terhadapnya. Rani mengaku dipegang-pegang oleh atasan- nya itu pada saat pengukuran baju seragam. Ia juga mengaku sering diminta menemani tamu- tamu Eko ke tempat karaoke. Kasus itupun kemudian dita- ngani oleh Propam Polda Jatim dan semakin gencar diberitakan berbagai media. Beberapa kali dipanggil ke Polda Jatim, Briptu Rani mang- kir. Sampai pada Rabu (26/6) lalu, Rani bersama keluarganya datang ke Polda Jatim untuk menghadiri sidang KKEP atas laporannya dengan terperiksa AKBP Eko Puji Nugroho. Dalam sidang yang berlang- sung sejak pukul 16.00 WIB hingga 22.00 WIB waktu itu, Kapolres Mojokerto dinyatakan bersalah karena melakukan tin- dakan yang tidak patut. Yakni, sebagai pimpinan melakukan pengukuran baju anak buahnya tersebut. AKBP Eko Puji dinyatakan melanggar pasal 7 ayat 1 huruf i tentang KEPP (Kode Etik Pro- fesi Polri). Dan dalam sidang ini, dia diganjar hukuman mu- tasi yang bersifat demosi. Ar- tinya, dicopot dari jabatannya sebagai Kapolres Mojokerto dan bakal dipindahkan menja- di pamen (perwira menengah) di Polda Jatim. Kehadiran Rani dalam sidang itu benar-benar dimanfaatkan oleh Polda Jatim untuk menye- lesaikan semua perkara yang berkaitan dengannya. Usai mengikuti sidang, Polwan yang foto syur-nya sempat beredar di dunia maya ini langsung dima- sukkan ke dalam sel khusus di lantai tiga gedung Bid Propam untuk menjalani vonis 21 hari yang belum dijalaninya. Tak hanya itu, sidang KKEP terkait kasus disiplin Briptu Rani yang sempat dijadwalkan baru akan digelar tanggal 3 Juli 2013 pun diajukan menjadi, Jumat (28/6) kemarin. Akhirnya, Briptu Rani direkomendasikan pecat da- lam sidang tersebut. Dan sebelum dipecat, dia harus menjalani dulu hukuman selama 21 hari untuk mempertanggung jawabkan ke- salahannya. (ufi/fiq) Sertu Tri Juwanto, Sertu Anjar Rohmanto, Sertu Martinus Roberto, Sertu Suprapto, dan Sertu Hermawan Siswoyo. Kelima terdakwa dipersalah- kan melanggar Pasal 340 KUHP jo Pasal 55 ayat 1 KUHP. Subsi- dair pasal 338 KUHP jo Pasal 55 dan lebih Subsidair pasal 351 (1) jo ayat 3 KUHP jo Pasal 55 serta dikenai berlapis pasal 170 ayat (1) KUHP mengenai penganiayaan. Setelah menimbang, mencer- mati, dan mempelajari dari dua sudut pandang yang berbeda, kami majelis hakim memutus- kan tiga hal, kata Farida. Ketiga hal itu yakni menolak eksepsiataunotakeberatanyang disampaikan penasihat hukum terdakwa. Kedua mengenai su- rat dakwaan yang disampaikan Oditur Militer sudah sah. Atas dasar itu maka sidang dapat dilanjutkan dengan menghadirkan saksi, katanya. Sidang dipimpin Majelis Ha- kimLetkolChk(K)FaridahFaisal, Mayor Laut KH Hari Aji S, dan Mayor Sus M Idris tersebut di- tunda hingga Selasa 2 Juli dengan agendapemeriksaansaksi-saksi. Lima terdakwa ini turut mela- kukan aksi penyerangan Lapas Cebongan pada 23 Maret 2013 yang mengakibatkan empat tahanan titipan Polda DIY tewas dieksekusi ditembak mati. Aksi penembakan terhadap tahanan titipan Polda DIY yang merupakan tersangka pengeroyokan Serka Heru San- tosa, anggota Kopassus Grup II Kandang Menjangan hingga mengalami luka tusuk pada dada dan meninggal dalam perjalanan ke rumah sakit atas dasar solidaritas. Selain lima terdakwa, majelis hakim dengan terdakwa Sersan Satu Ikhmawan Suprapto juga menyatakan menolak seluruh eksepsi penasihat hukum ter- dakwa dan memutuskan me- lanjutkan persidangan. Penasihat hukum terdakwa dari TIM Pembela TNI sebe- lumnya menyatakan bahwa dakwaan Oditur Militer tidak jelas dan kurang lengkap se- hingga harus ditolak. Penasihat hukum berpen- dapat sebelum penyerangan kliennya tak tahu lokasi Lapas Cebongan sehingga dakwaan kepadanya tidak relevan. Ter- dakwa hanya sebagai sopir ken- daraan saat pergi ke Yogyakarta untuk mencari kelompok Marcel yang melakukan pembacokan terhadap Sertu Sriyono. Tolak Teleconference Sementara itu, Tim penasihat hukum 12 oknum anggota Ko- passus Grup 2 Kandang Men- jangan, menolak pemeriksaan saksi melalui teleconference. Ketua Tim Penasihat Hukum TNI AD Kolonel Chk Rokhmat yang mendampingi 12 terdak- wa seusai sidang di Pengadilan Militer II-11 Yogyakarta, Jumat mengatakan menolak usulan model teleconference dalam pemeriksaan saksi pada sidang kasus Cebongan. Dalam hukum acara tidak menghendaki pemeriksaan saksi melalui teleconference, katanya. Menurut dia, jika tidak ada halangan, saksi harus hadir, apalagi lokasi persidangan ada dalam satu daerah dan para saksi tidak sedang berada di luar pulau atau luar negeri. Alasan keamanan yang dikhawatirkan para saksi tidak perlu ditakutkan sebab ada aparat yang berjaga selama persidangan, katanya. Hal sama disampaikan ad- vokad senior Kamal Firadaus SH yang menyatakan bahwa kesaksian melalui teleconferen- ce hanya patut dilakukan jika saksi berda di luar daerah atau luar negeri. Kalaupun demi alasan ke- amanan, hanya bisa dilakukan telekonference apabila ada ancaman yang sangat besar. Dalam kasus ini saya tidak melihat ancaman yang sangat besar itu, katanya. Menurut dia, jika trauma, stres dan depresi, itu tidak menjadi alasan untuk menggu- nakan teleconference. Kepala Biro Hukum dan Humas Mahkamah Agung Ridwan Mansyur, mengatakan pihaknya telah menyiapkan perangkat elekronik untuk per- siapan telekonferensi, jika jadi diselenggarakan. Akan dilihat nanti ada ken- dala atau tidak dalam sidang pemeriksaan saksi pekan de- pan. Keputusannya ada pada majelis hakim, kata dia pada jumpa pers di Pengadilan Mili- ter II-11 Yogyakarta.(ant) Hakim Tolak... DARI HALAMAN 1■ ANTARA FOTO/Oky Lukmansyah PELEDAK HILANG - Inilah truk pengangkut bahan peledak berhenti di tempat istirahat jalur pantura, Desa Warureja,  Tegal, Jateng, Jumat (28/6). Menurut supir, Dedi, truk dari Jakarta menuju Flores membawa 10 Ton bahan peledak di antaranya detonator dan dinamit tersebut sebagian hilang. Berita dihalaman 8. join follow @portalsurya
  • 8. JAKARTA,SURYA -WakilKe- tua Komisi I DPR TB Hasanud- din memprediksi, 250 dinamit yang hilang bisa dipakai untuk meratakan gedung-gedung besar termasuk Istana Negara dan Kompleks Parlemen. Istana Negara bisa pakai 10-15 dinamityangdiletakkandiponda- sinya.GedungDPRdenganempat bangunan cukup 40 dinamit, ujar Politisi PDIP ini di Gedung DPR, Jakarta,Jumat(28/6). Karenanya, Hasanuddin me- mintaaparatkepolisianseriusme- nangani hilangnya dinamit milik PTBatuSaranaPersadaitu. Kapolri Jenderal Timur Pra- dopo mengatakan, pihaknya telah membentuk tim khusus untuk mencari dinamit yang hilang dalam perjalanan dari Subang ke Bogor, Jabar, ini. Tim dari Mabes Polri dan Polda Metro Jaya dan Polda Ja- bar ini, kata Timur, sedang fo- kus mencari. Kita tunggu saja hasilnya nanti, ungkapnya. Kepolisian, lanjut Timur, punya prosedur pengaman- an distribusi dinamit. Sistem pengamanan itu pun nanti akan dievaluasi, apakah ada unsur kelalaian petugas. Timur juga tidak dapat me- mastikan apakah pelaku pencu- rian dinamit itu kelompok tero- ris. Menurutnya, kepolisian akan bekerja sesuai bukti dan fakta di lapangan. Detasemen Khusus 88 Antiteror pun ikut dikerahkan untuk membantu penyelidikan. Diberitakansebelumnya,dua kardus seberat 50 kilogram ber- isi250dinamitdiketahuihilang, Kamis (27/6) sekitar 07.30 WIB. Alat peledak itu hilang dari dalam empat Mitsubishi Colt Diesel saat akan dikirimkan ke lokasi tambang PT Batusarana Persada di Desa Rengas Jajar, Kecamatan Cigudeg, Bogor. Dinamit itu diambil Rabu (26/6) sekitar pukul 14.00 WIB dari gudang PT MNK di Subang. Empat truk itu meng- angkut bahan peledak lainnya dengan jenis amonium nitrat 30.000 kg, dinamit 2.000 kg, dan detonator listrik 4.000 unit. Truk itu tiba di lokasi PT Batu- sarana Persada pada pukul 07.30 WIB. Saat diperiksa kru dan kepala teknik tambang PT Batu- sarana Persada, diketahui truk T 8952 TF itu telah sobek terpal penutupnya. Setelah dibongkar, beberapa kardus dinamit hilang. Terkait hilangnya dinamit, po- lisi sudah memeriksa 11 saksi di Mapolres Bogor. Kabid Humas Polda Jabar Kombes Pol Marti- nus Sitompul menyatakan, para saksi itu antara lain tiga kernet, empat supir, satu pengawal, dua satpam, dan satu manajer. Tak hanya itu, hilangnya di- namit memicu kewaspadaan di berbagai tempat, termasuk di Pelabuhan Tanjung Perak. “Kami mendapat telegram dari Polda Jatim untuk Siaga I, dengan memperketat peng- awasan di pelabuhan, kata Kompol Hadi Santoso, Kabag Ops Polres Pelabuhan Tanjung Perak, kemarin. Sebanyak 175 personel Polres Pelabuhan Tanjung Perak dike- rahkan untuk menggelar razia di Dermaga Roro dan penyebe- rangan Ujung. Pemeriksaan de- ngan metal detector dilakukan terhadap truk-truk yang antre menunggu kapal. Razia juga digelar Polres Sukabumi Kota dan Polres Ka- rawang, Jabar. Kapolri mengakui lemahnya pengamanan pengangkutan dinamit. Kalau saya lihat dari hasil laporan, ya memang kurang, katanya. Apalagi, ka- tanya, empat kendaraan yang mengangkut itu hanya dikawal dua petugas. Ada berapa kendaraan cuma diamankan dua orang, jadi ku- rang, berarti ada evaluasi, ujar- nya. Ini, katanya, adalah kece- lakaan. Maka, jika ada kelalaian, siapapun akan diproses. Tapi sekarang kita fokus mencari ba- rang (dinamit) itu, tegas kapolri sembari meminta agar kejadian ini tak terulang. (tribunnew/ ant/kompas/ook) Dinamit Hilang Bisa Sapu Istana Kapolri Akui Lemahnya Pengamanan■ TRIBUN JAKARTA/JEPRIMA ALUMNI SMA 3 - Penyanyi kawakan asal Belanda, Daniel Sahuleka menyanyikan sebuah lagu saat hadir dalam konferensi pers Reuni Teladan All Star di SMAN 3 Setiabudi, Jakarta Selatan, Kamis (27/6). Reuni dalam rangka memperingati HUT ke-60 SMAN 3 dimeriahkan oleh para alumni sendiri, seperti Faris RM, Adie MS, Memes, dan sejumlah artis lainnya. Mobil Mewah Diatasnamakan Adik,Ipar,Paman JAKARTA, SURYA - Banyak cara dilakukan mantan Kepala Korps Lalu Lintas (Korlantas) Polri Irjen Djoko Susilo untuk menyamarkan harta kekaya- annya. Selain memiliki tiga istri, Djoko juga minta para istrinya mengatasnamakan hartanya kepada saudara- saudaranya. Cara Djoko ini terungkap pada persidangan di Pengadilan Tipikor, Jumat (28/6). Mahdiana dinikahi Djoko pada 27 Mei 2001. Sebelum menikah, Mahdiana bekerja di perusahaan swasta di Jakarta. Namun setelah me- nikah dengan Djoko, Mahdi- ana mendadak kaya. Perem- puan ini bisa membeli mobil mewah, tanah dan rumah miliaran rupiah. Adik Mahdiana yakni Novi Indah menuturkan, kakaknya memiliki banyak harta setelah menikah dengan 'Mas Dika', panggilan Djoko Susilo. Novi pernah dibelikan rumah oleh Mahdiana sebagai hadiah perkawinan.Setahu saya iya (banyak harta setelah menikah dengan Djoko), kata Novi saat bersaksi di Pengadilan Tipikor, Jakarta, kemarin. Novi mengaku tak tahu dan tak pernah menanyakan asal usul kekayaan kakaknya. Ia hanya mengetahui Mahdiana memiliki bisnis salon dan resto- ran. Novi juga pernah menjadi supervisor di restoran milik Mahdiana di Central Park, Ja- karta yang dibuka tahun 2008. Dari mana sumbernya saya tidak tanya, ujar Novi. Sementara paman Mahdi- ana, M Zainal Abidin yang juga bersaksi membenarkan keponakannya itu memiliki harta miliaran rupiah. Sebelum memiliki usaha salon di Jalan Margasatwa, Ragunan, Jakarta Selatan, Mahdiana hanya me- miliki usaha salon kecil. Pada sidang terungkap Mahdiana memiliki mobil- mobil mewah. Antara lain Jeep Wrangler, Toyota Fortuner dan Toyota Harrier. Belum lagi mobil-mobil berkategori harga sedang seperti Toyota Innova, Toyota Avanza dan Nissan Serena. Namun mobil-mobil tersebut diatasnamakan adik, paman dan saudara iparnya. Novi awalnya mengaku ti- dak tahu perihal kepemilikan beberapa mobil mewah milik Mahdiana yang diatasnama- kan dirinya. Namun, setelah dipanggil KPK, Novi baru tahu KTP-nya dan KTP sua- minya yang pernah dipinjam Mahdiana, ternyata diguna- kan untuk membeli dan mem- buat surat surat mobil mewah tersebut. (tribunnews) Akhirnya Libur Bareng Anak MAIA S ETELAH bercerai dengan Ahmad Dhani, hidup Maia Estianty justru menjadi lebih menyenangkan. Paling tidak, itu pengaku- an ibu tiga anak itu. Ia tengah berbahagia karena dapat menikmati libur bersama tiga anaknya, Al, El, Dul di Bali. Mereka dijadwalkan liburan sebelum Lebaran. “Sebelum Lebaran terbang ke Bali, sama anak- anak dan Mey Chan. Itu kali pertama saya bisa liburan bersama ketiga jagoan saya,” ucapnya, Jumat, (28/6), saat ditemui di Epicentrum, Kuningan, Jakarta. Rencana liburan tersebut merupakan inisiatif Al. Ia minta Maia mengosongkan jadwal untuk liburan. Tentu saja Maia langsung mengiyakan. Ia bersyukur karena Ahmad Dhani juga mengizinkan. Kebetulan Dhani juga tengah di Bali. Tapi dia punya acara sendiri, tukas Maia. Perpisahan dengan Dhani membuat Maia bebas menentukan jalan hidupnya. Resmi menjadi janda, Maia ingin ketiga anaknya menerima kehadiran suami barunya nanti layaknya ayah sendiri. “Saya juga ingin punya suami dan anak- anak bisa menerima bapak tirinya dengan baik,” ungkap Maia yang bercerai karena tahu suaminya menikah lagi dengan Mulan, rekan duetnya di Ratu. (Tribunnews) Persebaya DU Butuh 54 Menit untuk Bekuk PSBS SURABAYA, SURYA - Tidak ada jumlah gol besar di Sta- dion Gelora Bung Tomo (GBT) ketika Persebaya DU melakoni pertandingan babak 12 besar Divisi Utama melawan PSBS Biak. Sebaliknya, Persebaya DU memeras keringat sampai 54 menit untuk memetik hasil tipis 1-0 atas PSBS pada laga Grup B, Jumat (28/6) petang. Di awal babak pertama, Uston Nawawi dkk bisa mendominasi pertandingan. Pertahanan PSBS sering dibombardir, namun Per- sebaya DU tak kunjung meme- tik gol. Di menit ke-29, bomber Persebaya DU Jean-Paul Boums- ong, yang berhadapan dengan kiper PSBS, Yusak Samuel, ga- gal mencetak gol. Tendangan Boumsong ditangkap Yusak. Usai turun minum, Persebaya DU bermain makin spartan. Se- rangan yang dibangun melalui jenderal lapangan tengah, Srdan Lopicic, sering mengancam ga- wang PSBS. Di menit ke-54, memanfa- atkan kemelut depan gawang PSBS, Boumsong sukses mem- bobol gawang PSBS. Skor 1-0 untuk Persebaya DU. Pelatih Persebaya DU Tony Ho mengungkapkan, keme- nangan ini diraih susah payah karena PSBS diperkuat pemain yang memiliki motivasi tinggi. Pemain PSBS memiliki mo- tivasi tinggi. Inilah yang saya tekankan kepada pemain sebe- lum kick-off. Kami bisa menang melalui perjuangan keras, tegas Tony usai pertandingan. Menurutnya, finishing pemain- nya masih lemah. Dari delapan peluang emas, Persebaya DU hanya mencetak satu gol. Fi- nishing touch anak-anak masih lemah. Harus di benahi agar tidak buang peluang lagi la- wan PSIS Semarang (7 Juli), aku Tony. Di grup B, Persebaya DU duduk di peringkat kedua (3 poin). Tempat teratas dikuasai PS Bangka yang menang 2-1 atas PSIS. (edr) HALAMAN 8 | SABTU, 29 JUNI 2013 35 Tahun Panjangkan Rambut RAMBUT PANJANG - Li Menglu (49) menunjukkan rambutnya yang panjang di Xi'an, provinsi Shaanxi, China. Rambut Li panjangnya mencapai 1,7 meter, yang dipelihara selama 35 tahun. Sejak kecil Li memang menyu- kai rambut panjang, karena merupakan mahkota bagi wanita.(asianewsphoto) 250 Batang dinamit yang hilang bisa dipakai untuk kegiatan teror. Polri membentuk tim khusus untuk mengusut dinamit yang hilang. Polri sudah memeriksa 11 saksi. Razia kendaraan dilaku- kan di berbagai tempat. ■ ■ ■ ■ STORYHIGHLIGHTS Akhirnya Libur Bareng Anak liburan. Tentu saja Maia langsung mengiyakan. mengizinkan. Kebetulan Dhani juga tengah di Bali. Tapi dia punya acara sendiri, tukas Maia. Perpisahan dengan Dhani membuat Maia bebas menentukan jalan hidupnya. Resmi “Saya juga ingin punya suami dan anak- tahu suaminya menikah lagi dengan Mulan, karena PSBS diperkuat pemain yang memiliki motivasi tinggi. Pemain PSBS memiliki mo- tivasi tinggi. Inilah yang saya tekankan kepada pemain sebe- . Kami bisa menang melalui perjuangan keras, tegas Tony usai pertandingan. finishing pemain-finishing pemain-finishing nya masih lemah. Dari delapan peluang emas, Persebaya DU hanya mencetak satu gol. Fi- anak-anak masih lemah. Harus di benahi agar tidak buang peluang lagi la- wan PSIS Semarang (7 Juli), Di grup B, Persebaya DU duduk di peringkat kedua (3 poin). Tempat teratas dikuasai PS Bangka yang menang 2-1 atas PSIS. (edr) TRIBUN JAKARTA/JEPRIMA Apakah hilangnya 250 dinamit terkait teroris? join follow @portalsurya
  • 9. | K etua DPRD Surabaya, Muhammad Machmud mengungkapkan, dise- mayamkanya jenazah Imanuel di DPRD sebagai wujud peng- hormatan terhadap almarhum sebagai anggota dewan. Kami beri kesempatan se- genap anggota dewan dan staf sekretariat memberikan peng- hormatan terakhir pada pak Imanuel, kata Machmud. Sekitar pukul 13.30, upacara penghormatan dan pelepas- an jenazah Imanuel di DPRD Surabaya selesai. Peti Jenazah langsung diusung oleh petugas pengamanan dalam DPRD Suasana duka menyelimuti segenap anggota DPRD dan staf Sekretariat DPRD Surabaya saat me- nyambut kedatangan jenazah anggota Fraksi Partai Damai Sejahtera, Imanuel Frederik Lumoindong. Jenazah sebelum dimakamkan di TPU Keputih disemayamkan sejenak di DPRD, Jumat (28/6). Semayamkan Jenazah Imanuel Lumoindong di DPRD Surabaya Tradisi Baru Bagi Anggota Dewan yang Meninggal surabaya, surya - Perju- angan Nabila Alifia Kusuma dan Mochamad Afni masuk ke sekolah kawasan akhirnya membuahkan hasil. Sebelumnya kedua siswa ini sempat terpental dari pagu meski nilainya lebih tinggi dari pagu terendah. Nilai Nabila yang mendaftar di SMAN 1 Surabaya 112,5150. Sedangkan nilai terendah SMAN 1 hanya 109,5225. Kemu- dian nilai Afni yang mendaftar di SMAN 6 sebesar 113,5375 dan pagu terendah 113,1200. Dinas Pendidikan (Dindik) Surabaya pun mengakui kesa- lahannya dalam pengumuman hasil pemenuhan pagu. Kedua- nya lalu dimasukkan daftar sis- wa yang lolos sekolah kawasan. Nabila terdaftar di SMAN 1, se- dangkan Afni di SMAN 6 Sura- baya. Abdullah Faqih, orangtua Nabila, mengungkapkan, Jumat (28/6) pagi dirinya dihubungi pihak Dindik. Dindik meminta maaf atas kesalahannya. Alham- dulillah Nabila akhirnya ma- suk, katanya. Kabar itu lalu ditindaklanjuti Nabila dengan daftar ulang ke SMAN 1 yang menandakan dia siswa kurang mampu yang gagal lolos jalur mitra warga sekolah negeri masih berkesempatan memperoleh sekolah tak berbayar. Caranya dengan mendaftar di jalur mitra warga sekolah swasta. Jalur mitra warga ini harus diterapkan semua sekolah swasta, tidak terkecuali swasta favorit dan ternama. Itu artinya, semua sekolah swasta harus memasukkan minimal lima persen siswa tidak mampu (miskin) ke sekolahnya. Ketua Komisi D DPRD Su- rabaya, Baktiono, mendesak Dinas Pendidikan (Dindik) Sura- baya menutup izin operasional sekolah yang menolak mene- rapkan sistem mitra warga. Pasalnya semua sekolah sudah meneken naskah perjanjian hi- bah daerah (NPHD) yang berisi kesanggupan mereka untuk memasukkan siswa miskin di sekolahnya. ”Kalau memang ada sekolah swasta yang tidak mau, mereka harus diberi- kan teguran, peringatan tertulis hingga pemberhentian izin ope- rasional,” tegas politisi PDIP ini, Jumat (28/6). Menurutnya, mitra warga ini sifatnya wajib karena sudah diatur di dalam Perda 16/2012 tentang Penyelenggaraan Pen- didikan. Terpisah, Kepala Bidang Pendidikan Menengah dan Kejuruan Dindik Surabaya, Rudy Winarko, menegaskan pihaknya Tapi anehnya rencana kami untuk membawa KBS lebih baik dan maju dari sekarang kok tidak direspon oleh Kemenhut.Ya akhirnya kami minta tanah KBS. tri rismaharini wali kota surabaya Nabila-Afni Akhirnya Masuk Kawasan Pilihan Harus Dalam Satu Sub Rayon ■ ■ KE HALAMAN 15■ KE HALAMAN 15■ SURYA/AHMAD ZAIMUL HAQ BERDUKA - Yosta Lumoindong (dua kiri), istri Imanuel Lumoindong, tak kuasa menahan sedih saat menghadiri persemayaman di DPRD Surabaya, Jumat (28/6). SURYA/AHMAD ZAIMUL HAQ EKSEKUSI KBS - Salah satu sudut kawasan Kebun Binatang Surabaya diambil dari ketinggian. Wali Kota Surabaya Tri Rismaharini akan melaksanakan eksekusi KBS pada 1 Juli 2013. Tak Ada Tuslah untuk Angkutan Mudik S u r a baya , surya - Peme- rintah memastikan tidak akan memberla- kukan tuslah atau kenaikan tarif untuk angkutan arus mudik dan arus balik Lebaran 2013. Kepastian ini disam- paikan oleh Wakil Menteri Perhubungan, Bambang Su- santono, di sela peluncuran buku Transportasi dan Investasi, Tantangan dan Perspektif Multidi- mensi di TB Gramedia Tunjung- an Plaza, Jumat (28/6). Senin lalu, karena kenaikan BBM sudah ada kenaikan ta- rif angkutan umum yang dike- lola pemerintah pusat sebesar 15 persen, sehingga untuk Le- baran tidak ada kenaikan tarif lagi. Apalagi saat ini bersamaan juga dengan kenaikan kelas dan masa pendaftaran sekolah, jelas Bambang. Banyaknya pengeluaran yang dialami masyarakat, termasuk untuk mencukupi kebutuhan Lebaran, membuat pemerintah menunda dulu untuk membe- rikan kenaikan tarif angkutan umum lagi. Namun diakui Bam- bang, pihaknyha tetap memper- hatikan para operator angkut- an umum dengan memberikan subsidi kepada para pengusaha operator agar tetap operasional tanpa menggantungkan penda- patan dari para pengguna ang- kutan. Dengan kata lain, lanjutnya, subsidi itu diberikan untuk te- tap membuat operator bisa ope- rasional. Termasuk saat arus KE HALAMAN 15■ Ibu Asuh Prajurit Tidur Dalam Penny Marsetio P ada11 Juni 2013, bertempat di Cilandak, Jakarta Selatan, Penny Marsetio, resmi diangkat menjadi ibu asuh prajurit Tidur Dalam Korps Marinir. Kerena itulah, istri Kasal Lak- samana Marsetio ini, Jumat (27/6), mengunjungi prajurit Tidur Dalam Korps Marinir yang berada di Bhumi Marinir Karangpilang, Surabaya. Kedatangan Penny Marsetio yang didampingi Ketua Pengurus Ga- bungan Jalasenastri Korps Marinir, Mediastuti Faridz Washington dan para Pengurus Jalasenastri Pusat di Bhumi Marinir Karangpilang, disambut oleh Komandan Pasmar-1 Brigjen TNI (Mar) Sis- woyo Hari Santoso, Ketua Korcab Pasmar- 1 Ny Siswoyo dan para Pengurus Korcab Pasmar-1. surabaya, surya - Mendu- nianya persoalan Kebun Binatang Surabaya (KBS) justru membu- latkan tekad Pemkot Surabaya untuk segera mengeksekusi tanah dan mengambil alih. Apalagi saat ini Pemkot Surabaya sudah mem- persiapkan BUMD KBS yang akan langsung bekerja ketika proses pengambilalihan dilaksanakan. Saya ditanya dari seluruh du- nia soal KBS itu sampai malu, ma- kanya pengambil alihan akan kita lakukan 1 Juli 2013 nanti, kata Tri Rismaharini, Wali Kota Surabaya usai menghadiri rapat paripurna di DPRD Surabaya, Jumat (28/6). Di samping telah menyiapkan BUMD, dikatakan Risma, pemkot juga telah menyiapkan tim audi- tor independen untuk mengaudit seluruh sarana dan prasarana ser- ta binatang di KBS. Hal ini untuk mengetahui apa saja yang dibu- tuhkan nantinya setelah pengam- bilalihan. Sebetulnya, disebutkan Risma, dalam proposal yang diajukan ke Kementerian Kehutanan (Ke- menhut) tersebut sejumlah renca- na perbaikan dan perluasan KBS telah dicantumkan. Di antaranya bagaimana memperluas kandang binatang, menambah berbagai sa- rana wisata, membangun fasilitas penunjang dan sebagainya. KBS nantinya juga akan dilengkapi de- ngan sarana wisata dan bermain anak berkelas dunia. Tapi anehnya rencana kami un- tuk membawa KBS lebih baik dan maju dari sekarang kok tidak dires- pon oleh Kemenhut. Ya akhirnya Saya Ditanya Soal KBS Sampai Malu Nabila akhirnya masuk SMAN 1 dan Mochamad Afni masuk SMAN 6 Dindik Surabaya langsung menghubungi orang tua siswa untuk meminta maaf Memiliki nilai tinggi tapi memelih sekolah tidak dalam satu sub rayon, tak akan masuk pagu Untuk PPDB reguler, siswa dan orangtua diminta lebih cermat lagi dalam penentuan sub rayon ■ ■ ■ ■ storyhighlights KE HALAMAN 15■ HALAMAN | | SABTU, 29 JUNI 2013 Kakek berusia 63 tahun memimpin komplotan pencuri sekitar 50 ekor sapi di wilayah pantura Lamongan. Reju, sang kakek yang terpaksa ditembus timah panas tepat kaki kirinya dibekuk petugas bersama tiga rekannya, Jumat (28/6). baca halaman 12 Tunjungan Life Sekolah Swasta Harus Terapkan Mitra Warga Salah Mengaku Dindik dan Minta Maaf KE HALAMAN 15■ kakek pimpin curi 50 sapi SURYA/sri handi lestariKE HALAMAN 15■ join follow @portalsurya
  • 10. KEPANJEN, SURYA - Guna pe- ningkatan pelayanan wisatawan, angkutan umum penumpang yang melalui jalur kawasan pegu- nungan Bromo Tengger Semeru (BTS) akan ditata. Dinas Perhu- bungan Komunikasi dan Informa- tika (Dishubkominfo) Kabupaten Malang bersama paguyuban ang- kutanumummenyepakatiadanya penertiban jalur agar tidak saling berebutpenumpang. Demikian hasil rapat koor- dinasi Dishubkominfo dan pa- guyuban tersebut di Tumpang, Jumat (28/6). Rapat melibatkan paguyuban jip, paguyuban Tumpang-Arjosari (TA) dan pa- guyuban Gubuk Klakah-Tum- pang-Madyopuro (GTM). “Tidaksemuaangkutanumum boleh mengantar wisatawan ke BTS,apalagitidaksesuaijalurnya. Selain itu, truk dilarang memba- wa penumpang karena bukan kendaraan mengangkut penum- pang tapi barang,”jelas Untung Sudarto, Kabid Lalu Lintas dan Angkutan Dishubkominfo Ka- bupaten Malang usai pertemuan. Dikatakan, hasil rapat kordinasi tersebut akan disosialisasikan ke para anggota paguyuban. Selama ini, lanjut Untung, tak sedikit angkutan yang menyalahi jalur karena meme- nuhi permintaan wisatawan untuk mengantar sampai ke tujuan. Dengan penertiban ini, misalkan, ada penumpang atau wisatawan yang naik Malang Life G REGORIUS Ferry Yuli- anto (21), mahasiswa UMC Malang, ini tidak patah arang, sekalipun sudah banyak jamu pelangsing tubuh yang beredar. Terbukti, Iyus, sapaan Gregorius Ferry Yulianto, mampu menciptakan jamu pelangsing tubuh dengan bahan yang tergolong sangat unik, yaitu dari bahan pigmen (zat warna) berbagai tumbuh- an khas Nusantara. Ramuan herbal pelangsing tubuh buat- an Iyus ini diberi nama Jamu Anti-obesitas (JAO). Menurut mahasiswa asli Malang ini, kebiasaan pola hi- dup masyarakat sekarang yang cenderung serba instan mem- buka ruang lebar seseorang menderita obesitas (kelebihan berat badan). “Sekarang banyak tempat makan yang menyajikan junk food. Namun, junk food Waspada Muncul Pagu Siluman Warga Diimbau Ikut Awasi■ MALANG, SURYA - Lemba- ga Malang Corruption Watch (MCW) meminta warga Kota Malang bersama-sama ikut mengawasi pelaksanaan peneri- maan peserta didik baru (PPDB) online SMAN dan SMPN, pada Senin – Kamis (1-4/7) nanti. Se- bab, MCW menilai sistem online tetap membuka peluang terjadi- nya kecurangan. Divisi Advokasi MCW, Za- inuddin, mengatakan, meski pagu semua sekolah negeri sudah dirilis Dinas Pendidikan (Dindik) Kota Malang, tetap membuka peluang adanya pagu siluman yang diperuntukan bagi para oknum pelaku PPDB curang. Oknum ini bisa beru- pa wali murid, pihak sekolah, Dindik, pemilik kekuasaan, dan lainnya. “Pagu-pagu yang dirilis seka- rang masih berpotensi bertam- bah lagi. Tapi tidak diumumkan, melainkandari‘jalanbelakang’,” kata Zainuddin, Jumat (28/6). Zainuddin menjelaskan se- kolah-sekolah tertentu bisa saja menyiapkan pagu siluman ini untuk diperjualbelikan atau titi- pan pihak-pihak tertentu. “Ter- utama sekolah-sekolah favorit. KE HALAMAN 15■ Banyak sudah produk jamu peramping tubuh beredar dengan berbagai bahan maupun bentuknya. Namun, seorang mahasiswa Uni- versitas Ma Chung (UMC) Malang mampu menciptakan ramuan herbal ini dengan bahan yang sangat unik. Mahasiswa Ma Chung Temukan Jamu Anti-obesitas Berbahan Bakukan Pigmen Tumbuhan Khas Nusantara SURYA/NEDI PUTRA AW JAMU PIGMEN - Mahasiswa Prodi Teknik Industri Fakultas Sains dan Teknologi, Gregorius Ferry Yulianto, bersama dosen pembimbingnya Leenawaty Limantara PhD, menunjukkan jamu antiobesitas (pelangsing) berbahan pigmen hasil penelitian di Universitas Ma Chung Malang, Jumat (28/6). Jamu anti obesitas ini dibuat melalui penelitian di Ma Chung Research Center for Photosynthetic Pigments (MRCPP) di kampus tersebut Rp 100 Juta untuk Desa Wisata BATU, SURYA - Lima desa wisata di Kota Batu akan di- guyur dana pengembangan wisata dari pemerintah pusat melalui Program Nasional Pemberdayaan Masyarakat (PNPM) Mandiri Kementerian Pekerjaan Umum. Lima desa itu akan mendapatkan anggar- an masing-masing Rp 100 juta. Kelima desa wisata yang mendapatkan dana adalah, Desa Punten yang mengan- dalkan wisata petik apel, Desa Gunungsari dengan wisata pe- tik buang mawar dan Desa Bu- lukerto yang memiliki potesi wisata budidaya kelinci hias. Sedangkan dua desa lainnya adalah Desa Pandanrejo dengan wisata petik buah stroberi dan Desa Tlekung yang mengan- dalkan keindahan wisata alam dengan wisata air terjun Coban Putri dan camping ground. “Satu lagi desa wisata yang mendapatkanadalahDesaSum- berejo. Desa ini sudah tiga kali ini mendapatkan dana PNPM. Di sana, masyarakat mengguna- kannya untuk pengembangan wisata petik sayur. Paket peng- ajuanproposalsemuadesakami pada Maret 2013,” ujar Mistin, Kepala Dinas Pariwisata (Dis- parta) Kota Batu. Sementara itu, Kepala Desa Pandanrejo, Abdul Manan menyatakan, dana sebesar itu akan digunakan untuk prog- ram penanaman buah stroberi di wilayahnya. Setiap kepala keluarga akan Berbagi Rezeki lewat Penataan Jalur Angkutan BTS SURYA/IKSAN FAUZI PUNCAK SEMERU - Pemandangan puncak Gunung Semeru dari Pos Kalimati. Dishubkominfo Kabupaten Malang melakukan penertiban angkutan umum yang menuju kawasan Bromo Tengger Semeru demi memberi kenyamanan bagi wisatawan. MK telah menolak gugatan pasangan SR- MK dan RAJA Pihak SR-MK menerima dan menghormati putusan MK Salinan putusan diserahkan ke DPRD Senin (1/7) Anton - Sutiaji akan dilantik di gedung baru DPRD ■ ■ ■ ■ STORYHIGHLIGHTS Putusan MK Sudah Diprediksi MALANG, SURYA - Komisi Pe- milihan Umum (KPU) Kota Ma- lang segera menyerahkan salinan putusan Mahkamah Konstitusi (MK) ke DPRD Kota Malang. Hal ini setelah MK mengambil kepu- tusan atas sengketa hasil Pilwali Malang yang menolak gugatan pasangan Sri Rahayu-Priyatmo- ko Oetomo (SR-MK) dan Mujais- Yunar Mulya (RAJA). “Dengan putusan tersebut maka Pilwali dimenangkan oleh pasangan nomor 6, M Anton- Sutiaji (AJI),” terang Komisioner KPU Kota Malang Divisi SDM, Organisasi dan Hubungan Masyarakat, Zaenudin, Jumat (28/6). Rencananya salinan putusan MK akan diserahkan ke DPRD Kota Malang, Senin (1/7). Zaenudin menyebut, putusan MK tersebut dibacakan Kamis (27/6) pukul 16.00 WIB di Ja- karta. Gugatan Raja dinilai tidak memenuhi legal standing sehing- ga permohonannya tak diterima. Sementara gugatan SR-MK dito- lak karena terlambat didaftarkan. HALAMAN 9 | | SABTU, 29 JUNI 2013 BRAWIJAYA CORET 68 CAMA JALUR UNDANGAN Jumlah calon mahasiswa (Cama) dari jalur undangan atau yang sekarang bernama Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) Universitas Brawijaya (UB) kembali berkurang. Menurut Kepala Humas UB, Dra Susantinah Rahayu, UB mencoret 68 Cama dari jalur SNMPTN. “Sebelumnya ada 7.757 orang yang dinyatakan lolos, tetapi hanya 6.559 orang yang daftar ulang. Sekarang berkurang lagi menjadi 6.491 orang,” kata Susantinah kepada Surya, Jumat (28/6). Perempuan yang biasa disapa Santi ini menuturkan, nilai rapor yang diberikan ke-68 saat daftar ulang SNMPTN pada 18-19 Juni lalu berbeda ketika dilakukan verifikasi oleh Panitia Pusat SNMPTN. “Nilai rapor yang diberikan ternyata lebih tinggi dari nilai aslinya,” sambung Santi. Atas kenyataan itu, ke-68 orang ini dicekal tidak bisa masuk UB, beserta lembaga sekolah asal mereka.(isy) | KE HALAMAN 15■ KE HALAMAN 15■ KE HALAMAN 15■ KE HALAMAN 15■ Malang LifeMalang LifeHALAMAN Malang LifeMalang Life9 Malang Life|| Malang Life| Malang Life|| Malang Life| Malang LifeSABTU, Malang LifeSABTU, Malang LifeMalang Life29 JUNI 2013 Malang Life ke-68 saat daftar ulang SNMPTN pada 18-19 Juni lalu berbeda ketika dilakukan verifikasi oleh Panitia Pusat SNMPTN. “Nilai rapor yang diberikan ternyata lebih tinggi dari nilai aslinya,” sambung Santi. Atas kenyataan itu, ke-68 orang ini dicekal tidak bisa masuk UB, beserta lembaga sekolah asal mereka. Malang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang LifeMalang Life join follow @portalsurya
  • 11. 10 | SURABAYABLITZ SABTU, 29 JUNI 2013 | surabaya, surya - Empat orangsekuritidanseorangcleaning service Carrefour ITC Mega Grosir di Jalan Gembong Surabaya, ha- rus meringkuk di dalam penjara Polsek Simokerto, Jumat (28/6). Mereka adalah Anang Fir- manto (24), warga Kepohbaru, Bojonegoro, yang ngekos di Ja- lan Wonosari Surabaya; Eko Ba- gus (18) warga Sumberrejo, Bo- jonegoro yang tinggal di Jalan Embong Kertajaya I Surabaya; Heru Agus (33), warga Kedung Baruk II Surabaya dan Ahmad Syafii (19), warga Jalan Tanah Merah I Surabaya. Sedangkan seorang clea- ning service yang juga ditang- kap adalah Mashuri (22) warga Kampung Seng Surabaya. Lima orang tersebut ditangkap polisi setelah ketahuan mencuri se- jumlah barang dagangan di Car- refour, tempat mereka bekerja. Berbagai barang dan makan- an mereka curi. Termasuk celana, pakaian, tas, kasur lipat, makan- an dan sebagainya yang totalnya Rp 4 juta, ungkap Kanit Reskrim Polsek Simokerto, AKP M Yasin. Dari lima orang itu, yang per- tama diringkus adalah Anang Firmanto. Dia ketahuan men- curi kasur lipat saat piket jaga. Modusnya, kasur dikeluarkan dari Carrefour, kemudian pas jam pulang, dibawa keluar dari area mal. Setelah berhasil menangkap Anang, polisi kemudian meng- amankan satu-persatu satpam di pusat perbelanjaan tersebut yang juga kerap mencuri ba- rang-barang dari tempat yang mestinya mereka amankan. Ter- masuk seorang cleaning service juga digelandang lantaran ikut terlibat dalam pencurian ini. Dalam pemeriksaan, lima ter- sangka itu mengaku belum sem- pat menjual barang-barang hasil kejahatannya. Hanya sejumlah makanan ringan yang sempat mereka nikmati. Belum sempat ada yang dijual, jawab Anang di Polsek Simokerto. (ufi) Jaksa Tunggu Kejiwaan Suwardi Stabil surya/haorrahman Simpul Kemacetan - Kapolrestabes Surabaya Kombes Pol Setija Junianta saat mengatur arus lalu lintas di Jalan Raya Darmo, Jumat (28/6) pagi. SURYA/AHMAD ZAIMUL HAQ TARI KREASI - Sejumlah anak menarikan Tari Kacokang dari Kalimantan Barat dalam Festival Nasional Tari Kreasi Baru Anak-anak 2013 di Gedung Cak Durasim, Jumat (28/6). Festival yang diikuti 33 provinsi di seluruh Indonesia itu akan digelar hingga Minggu (30/6). Empat Sekuriti Bobol Pusat Perbelanjaan Biro Reklame dan Pemkot Tertibkan Reklame Bermasalah surabaya, surya - Pemkot Su- rabaya bersama asosiasi biro reklame sepakat untuk melanjutkan survei ber- sama untuk menertibkan reklame ber- masalah yang masih saja tegak berdiri hingga sekarang. Kepala Dinas Cipta Karya dan Tata Ruang (DCKTR) Pemkot Surabaya, Agus Imam Sonhaji, mengatakan tim gabungan yang terdiri dari unsur DCKTR, Dinas Pendapatan dan Penge- lolaan Keuangan (DPPK), Satpol PP, serta asosiasi biro reklame melakukan operasi masing-masing di Jalan Tidar dan Jalan Kertajaya Indah. Di dua lo- kasi tersebut tim survei reklame men- dapati papan reklame berukuran 8 x 16 meter dalam kondisi kosong dan tidak ada tulisan apa pun. Reklame tersebut diketahui atas nama pemilik CV Oscar Advertising. Reklame itu tidak berizin alias bodong. Tim survei memberikan tanda silang warna merah di tiang reklamenya. Demikian pula de- ngan billboard yang ada di Jalan Kerta- jaya Indah. Reklame dengan ukuran 50 meter persegi itu tidak ada izinnya. Tim surveipun mengambil tindakan dengan menempel stiker tanda silang merah. Awalnya, menurut Agus, dari survei bersama yang pernah dilakukan ditemu- kan 954 titik reklame yang bermasalah. Sebanyak 50 di antaranya harus dibong- kar lebih dulu karena berukuran besar atau melebihi ketentuan. Reklame itu cukup membahayakan sehingga harus cepat dibongkar dalam waktu dekat, kata Agus yang memimpin langsung survei Reklame, Jumat (28/6). Memang, diakui Agus, sebagian reklame yang telah disurvei tim dan dinyatakan melanggar sudah banyak yang dipotong atau ditertibkan, sisa- nya masih ada 14 titik reklame bodong yang berdiri. Beberapa biro reklame yang bermasalah ternyata telah mem- bongkar sendiri reklamenya, sebagian lainnya dipotong oleh Satpol PP. Untuk selanjutnya, papar Agus, pi- haknya menyerahkan reklame-rekla- me yang sudah diberi tanda silang oleh tim survei untuk dieksekusi Satpol PP. Kami sepakat, semua reklame yang ti- dak punya izin ya harus dibongkar jika tidak dibongkar sendiri oleh pemilik- nya, tutur Agus. (aru) Perkara Pembunuhan Ibu Kandung Bisa Lanjut ■ surabaya, surya - Penanganan berkas perkara Supardi alias Suwar- di (sesuai KTP), yang tega membu- nuh ibu kandungnya, Akiyah (65), bisa tetap dilanjutkan. Tentu saja, syaratnya adalah kondisi kejiwaan Suwardi stabil alias waras. Kepala Kejati Jatim, Arminsyah, mengungkapkan untuk saat ini pi- haknya bisa melanjutkan penyidik- an bila tersangkanya dinyatakan su- dah sembuh. Jika di kemudian hari tersangka sudah dinyatakan sembuh oleh tim dokter penyidik, maka bisa diteruskan hingga disidangkan, je- lasnya di Kejati Jatim, Jumat (28/6). Ketika disinggung apakah ada masa kedaluwarsa oleh penyidik un- tuk meneruskan kasus, jika tersang- ka gila, dia tak menampiknya. Ar- minsyah mengungkapkan, di dalam pasal 78 KUHP, masa kedaluwarsa kasus pembunuhan biasa yang di- ancam hukuman pidana tiga tahun atau lebih adalah 12 tahun. Ada pun jika kasus pembunuhan berencana dengan ancaman hukuman pidana seumur hidup atau mati, kedaluwar- sanya 20 tahun. Dari itu kami bisa meneruskan kasus itu, ujarnya. Sedangkan Kasi Pidana Umum (Pidum), Kejari Surabaya, M Judhy Ismono, menyatakan, pihaknya memang telah menolak pelimpah- an berkas dari Polrestabes Suraba- ya. Kami terima dari BAP polisi bahwa Suwardi dinyatakan gila. Ya sudah, kami kembalikan di penyi- dik, katanya. Menurutnya, bila dinyatakan gila bagaimana tersangka bisa diperiksa dan menjalani sidang. Lagipula di BAP, pertanyaan pertamanya adalah apakah dia sehat waktu diperiksa, urainya. Ditambahkan, kejaksaan punya kewenangan untuk mengembalikan berkas perkara bila dianggap tak se- suai dengan hukum. Kami memakai dasar Pasal 44 Ayat 1 KUHP, di mana bahwa tersangka gila maka tak bisa dipidana, jelasnya. Seperti diketahui, Jaksa Penuntut Umum (JPU), Hendry Prabowo, di- rencanakan Senin (1/7) pekan depan akan mengembalikan BAP Suwardi ke Tim Penyidik Polrestabes Sura- baya. Dalam berkas itu terdapat lampir- an surat dokter yang menyatakan bahwa tersangka, Suwardi, meng- idap sakit jiwa. Di berkas tersang- ka tak mengaku kalau dia gila, tapi keluarga dan tetangga tersangka mengakui kalau tersangka pernah masuk rumah sakit jiwa. Seperti diberitakan sebelumnya, pembunuhan sadis ini terungkap berawal dari penemuan sosok wa- nita yang tergeletak dengan kondisi mengenaskan di rumahnya, sekitar 20 meter dari rumah pelaku di Jalan Bangkingan Timur II pada 14 Mei lalu. Kepala korban terpenggal. Da- danya terkoyak. Polisi mengungkap identitas kor- ban bernama Akiyah, dibunuh se- cara sadis oleh anak kandungnya sendiri, Suwardi. Akiyah tewas usai tengkuknya dipukul palu oleh anak ketiganya itu, kemudian dipenggal kepalanya menggunakan parang. Setelah itu dirobek dadanya meng- gunakan pisau dapur. Suwardi lan- tas mengambil hati ibunya itu. (sda) Kajati Arminsyah menyatakan jika Suwardi dinyatakan sembuh oleh dokter, perkaranya bisa lanjut hingga sidang Jaksa menolak pelimpahan berkas perkara dari polisi, karena Suwardi dinyatakan gila Di berkas, Suwardi tak mengaku kalau dirinya gila, tapi keluarga dan tetangga mengakui kalau tersangka pernah masuk RSJ. ■ ■ ■ storyhighlights Surabaya, surya - Pelim- pahan tahap kedua tersangka pembobol Bank Jatim, Carolina Gunadi rupanya menjadi aten- si kejaksaan. Terbukti, Kejari Surabaya memasang 10 jaksa penuntut umum (JPU) sekaligus untuk menghadapi persidangan Carolina. Kasi Pidana Khusus (Pidsus) Kejari Surabaya, Nurcahyo Jungkung Madyo menyatakan, perkara perkara ini pelimpahan dari Mabes Polri. Setelah berkas itu sempurna, maka pelimpahan tahap kedua ditujukan pada Kejaksaan Agung (Kejagung). Namun karena locus delicti- nya di Surabaya, maka berkas itu kemudian dilimpahkan ke Kejati Jatim, tuturnya kepada wartawan, Jumat (28/6). JPU dari Kejagung nantinya ada empat, dipimpin Budi Panjaitan. Sedangkan JPU dari Kejati Jatim ada tiga JPU yang akan mendampingi jaksa Kejagung. Sementara Kejari juga menunjuk tiga JPU yakni Andry Winarto, Wulan dan Hajar. Total ada 10 JPU yang menangani perakara Carolina ini, paparnya. Seperti diketahui, Carolina ditangkap Subdit Pencucian Uang Direktorat Tindak Pidana Ekonomi dan Khusus Bareskrim Polri sejak 27 Februari lalu. Pe- rempuan itu diduga berperan aktif dalam kasus pembobolan Bank Jatim Cabang HR Muham- mad Surabaya bersama suami- nya Yudi Setiawan, pada Januari sampai Maret 2011 dengan nilai kredit Rp 53,2 miliar. Untuk mendapat kredit itu mereka diduga menggunakan agunan fiktif. Untuk menghindarkan diri- nya dari jerat pidana, Carolina diduga sengan bercerai dengan Yudi yang kini tengah ditahan karena tersangkut kasus korupsi di Dinas Pendidikan Kabupaten Barito Kuala, Kalimantan Sela- tan. (sda) 10 Jaksa Tangani Perkara Carolina Gunadi surya/m taufik kompak mencuri - Lima tersangka pencurian di Carrefour ITC Mega Grosir saat berada di Mapolsek Simokerto, (Jumat 28/6). Kaleng Kerupuk Penumpang Kejutkan Polisi surabaya, surya - Hilangnya 2.000 kilogram dinamit di Jawa Barat, membuat Polres Pelabuhan Tanjung Perak mem- perketat pengamanan Pelabuhan Tanjung Perak. “Kami mendapat telegram dari Polda Jatim untuk Siaga I, dengan memperketat pengawasan di pelabuhan, kata Kompol Hadi Santoso, Kabag Ops Polres Pelabu- han Tanjung Perak, Jumat (28/6). Menurut Hadi, prioritas pengamanan karena hilangnya peledak serta rencana kedatangan Presiden RI di Surabaya. Sebanyak 175 personel Polres Pelabuhan Tanjung Perak, pengamanan dengan melakukan razia di Dermaga Roro dan penyeberangan Ujung. Pemeriksaan dilakukan terhadap truk-truk yang antre menunggu kapal di Demaga Jamrud, serta penumpang di Dermaga Gapura Surya. Pemeriksaan dilakukan dengan mem- bawa metal detector. Saat razia polisi sempat terkejut ketika metal detector berbunyi cukup keras saat memeriksa tas penumpang. Namun ternyata ketika dibuka hanya kaleng kerupuk. Razia ini kami lakukan secara berkala. Selain polres, polsek-polsek jajaran juga diperintahkan untuk meningkatkan open- sif, terutama pada jam-jam rawan, kata Hadi. (ook) Setija Ikut Atur Lalu Lintas di Daerah Rawan Macet SURABAYA, surya - Kapolre- stabes Surabaya Kombes Pol Setija Junianta memantau simpul-simpul kemacetan di Kota Surabaya yang sering dikeluhkan masyarakat, Jumat (28/6) pagi. Mengendarai mobil dinas, Setija mendatangi simpul-simpul kema- cetan mulai dari Jalan A Yani, Jalan Wonokromo, Jalan Raya Darmo, Jalan Bubutan, dan simpul-simpul kema- cetan lainnya. Di simpul-simpul ke- macetan itu, Setija juga ikut mengatur lalu lintas. Selain melihat anatomi kemacetan lalu lintas, saya juga ingin memasti- kan kesigapan anggota lantas dalam mengatur arus lalu lintas, terutama pada jam-jam rawan macet. Ketika ada kemacetan minimal ada polisi, agar pengguna jalan merasa aman, kata Se- tija yang sebelumnya pernah menjabat Wakapolwiltabes Surabaya. Inisangatpentingdilakukankarena pihaknya sering mendapat keluhan dari masyarakat, terutama pada jam berangkat dan pulang kerja. Kema- cetan di Surabaya masih menjadi ma- salah, kata mantan Kapolres Sidoarjo itu. Setelah memantau kemacetan, Setija akan koordinasi dengan Dinas Perhubungan (Dishub) Surabaya un- tuk membuat rekayasa lalu lintas. Usai memantau jalan rawan ma- cet, Setija Junianta juga melakukan inspeksi mendadak (sidak) ke bebe- rapa polsek jajaran. Sidak ini untuk melihat kesiapan polsek menjelang Ramadan. Menjelang Ramadan ini, Setija mengin struksikan kepada seluruh polsek jajaran untuk lebih sering patroli di wilayahnya, terutama di pemukiman penduduk. Ini untuk mengantisipasi tindak kriminalitas selama Ramadan yang biasanya me- ningkat. Bahkan, Setija mewajibkan semua anggota untuk membunyikan alarm rotator mobil patroli selama dua de- tik. Selama dua detik, dalam 10 menit sekali, anggota yang berpatroli harus membunyikan alarm rotator mobil patrolinya, pungkas Setija. (ook) join follow @portalsurya
  • 12. HALAMAN 11 | | SABTU, 29 JUNI 2013 Health Beauty TPGIMAGES.COM Buah Alami dan Pijat S emakin banyak hotel yang menawarkan perawatan kulit spa dan lulur yang mengguna- kan bahan alami dari buah-buahan. Bahan yang dipakai bisa berupa ekstrak buah atau buah-buahan segar yang dihaluskan.. Itu seperti Fruit Spa Therapy yang menggunakan ekstrak jeruk di Ten Eleven Spa and Fitness, Hotel Santika Pandegiling Surabaya. “Kulit jeruk yang dipakai berupa jeruk sunkist. Jeruk banyak mengan- dung vitamin C dan beraroma khas,” kata Yuliana, Koordinator Ten Eleven Spa and Fitness. Vitamin A yang dikandungnya berfungsi mencegah kanker kulit akibat paparan sinar matahari yang mengandung ultraviolet yang berbahaya bagi kulit. Vitamin C lebih berfungsi menjaga kelembapan kulit sehingga kulit tetap kenyal dan sehat. Tidak ketinggalan dalam proses spa itu dilakukan pijat memakai minyak aromaterapi. “Minyak ini dapat meregangkan dan menstimulasi aliran darah agar tubuh menjadi benar-benar rileks,” jelas Yuliana. Pemijatan ini dilakukan mulai dari kaki, tangan, hingga punggung. Sementara di Club Arena Spa and Fitness Centre, Hotel Ibis Surabaya Rajawali ditawarkan spa alpukat. Avocado atau buah alpukat kaya akan vitamin E dan mengandung omega 3. “Itu dapat menjadi antioksi- dan yang baik, mencegah penuaan dini, dan sebagai pelembap kulit alami,” kata Rezky Asena, Public Relations Hotel Ibis Surabaya Rajawali. Buah alpukat juga bersifat antiinflamasi sehingga dapat mendinginkan kulit. Itu cocok untuk kulit kering atau yang sering berada di dalam ruangan ber-AC. “Kami menawarkan ini karena banyaknya vitamin dan mineral yang dikandung. Orang seka- rang ingin bersentuhan dengan hal-hal yang natural,” papar Rezky. Setelah tubuh dan pikiran lelah selama sepekan, saatnya menikmati pijat dan lulur. Akhir minggu menjadi saat tepat untuk memanjakan tubuh. (ida) Lulur Alami Buatan Sendiri L ulur mengandung banyak kegunaan yang dibutuhkan oleh kulit seperti vitamin A yang terkandung di dalam bahan alami untuk menut- risi kulit. Asam laktat yang ada dalam lulur memban- tu membersihkan dan melembutkan kulit. Proses itu merangsang pembentukan kembali sel-sel kulit. Lulur dengan proses sempurna dapat merawat kulit supaya tidak kusam. Sel kulit mati yang luruh membuat kulit menjadi segar dan cerah. Lulur made in sendiri tidak kalah ampuh dengan lulur jadi. Justru dengan membuat sendiri, ada banyak pilihan dengan bahan alami yang terpilih. Cokelat bubuk, kopi, stroberi, susu, bengkuang, kulit kayu cendana, atau melati dapat menjadi campuran bahan dasar seperti beras, biji-bijian, garam mineral, atau gula berbutir kasar. Sebaiknya dipasti- kan butirannya cukup nyaman di kulit. Bahan tambahan seperti stroberi atau bengkuang dapat diblender dan dicampur dengan bahan dasar berbutir. Bahan lain yang sudah dalam bentuk serbuk atau cairan dapat langsung dicampurkan. Beri sedikit air sehingga menjadi pasta dengan kekentalan cukup. Sebelum mengoleskan lulur, pastikan tidak ada luka basah atau luka yang belum sembuh. Jika ada luka, lebih baik perawatan dihindari dulu. Oles selu- ruh tubuh menggunakan minyak zaitun atau minyak pijat. Beri pijatan lembut pada kulit. Setelah pijat, baru lulur dioleskan ke seluruh tubuh. Biarkan hingga setengah mengering dan gosok lu- lur hingga lepas dari tubuh. Lakukan dengan gerakan memutar. Pada bagian-bagian tertentu seperti lipatan kulit, lakukan penggosokan ekstra karena biasanya penumpukan kulit mati ada di sana. Bilas dengan air hingga bersih. Ketika kulit dalam kondisi lembap, segera oleskan pelembap kulit. Perawatan sederhana itu dapat dilakukan dua kali seminggu agar kulit tetap terjaga. (*) oleh C uaca Surabaya yang tak menentu dan cenderung panas, kerap membuat tubuh berkeringat. Belum lagi debu dan kotoran yang melekat setelah beraktivitas sepanjang hari. Luluran dan massage atau pijat dipilih perempuan Sura- baya sebagai solusi mempunyai kulit yang tetap sehat. Kulit sehat yang halus dan bersinar selalu menjadi damba- an perempuan terutama mereka yang hidup di perkotaan dan sudah tentu mengganggap perawatan kulit sebagai bagian gaya hidupnya. Banyak paket spa yang menawarkan sesi pijat dan lulur kulit ditawarkan berbagai hotel dan salon. Namun, ada pantasnya jika perlu mengetahui kelebihan dan kekurangan kedua jenis pera- watan tersebut sebelum masuk dan reservasi hari untuk rileks. Luluran yang memakai bahan tertentu dengan khasiat yang ditawarkan bermanfaat untuk mengangkat sel kulit mati. “Luluran itu sebaiknya dilakukan sebulan sekali,” ujar Siti Juariah, Supervisor Bali Garden Spa di Hotel Singgasana Surabaya, Jumat (28/6). Penyebabnya, kulit harus digosok agar terlihat bersih dari debu dan kotoran serta polusi udara. Cara ini juga untuk mengangkat sel kulit mati yang membuat kusam penampilan sehingga kulit sekaligus tubuh jadi sehat. Di sisi lain, jika terlalu sering luluran bukan membuat kulit menjadi sangat bersih dan berkilau, justru akan merugikan diri sendiri. Kulit menjadi kering seolah dehidrasi dan pecah-pecah. Walaupun luluran produksi minyak pada kulit. Sementara kulit bertipe normal diperbo- lehkan memakai berbagai jenis bahan lulur alami tadi. Kadang-kadang, perawatan lulur ini dapat mengombinasi- kan dua atau beberapa bahan. Seperti yang pernah dilakukan Ria pada spa Balinese Boreh. Pijat berbahan rempah-rempah itu memberi efek hangat. “Prosesnya ada luluran juga, tetapi tidak boleh digosok karena bahannya sudah hangat. Cukup diber- sihkan dengan mentimun, lalu dilap, dan dibersihkan dengan air hangat,” terang Ria. Pera- watan ini sesuai bagi mereka yang tengah masuk angin atau sedang tidak enak badan. Perempuan hamil juga dapat menikmati perawatan ini, karena berfungsi menghindari muncul- nya strechmark akibat pembe- saran janin. Namun, tetap perlu diperhatikan waktu yang tepat untuk luluran supaya tidak me- mengaruhi kondisi kesehatan saat hamil. (marta nurfaidah) memakai bahan alami, tetap saja akibatnya akan demikian. “Jika cuaca panas membuat kulit kering dan tubuh lemas, maka kalau sering luluran hanya membuat kulit tampak kering,” jelas Ria, panggilan akrab Siti Juariah. Maka, kesegaran tubuh perlu dijaga. Untuk ini, diperlukan rileksasi untuk mengurangi rasa lelah melalui spa. “Spa selain ada proses luluran, juga diberikan pijatan atau massage untuk membuat otot santai atau tidak kaku,” papar Ria. Jenis kulit berbeda akan me- nuntut perhatian yang berbeda pula. Untuk kulit kering, Ria menyarankan memakai bahan avocado, buah kiwi, atau co- kelat. Vitamin C dan lemaknya membuat kulit menjadi lebih kenyal dan lembap. Kulit berminyak dianjurkan memakai bahan mentimun dan lemon karena kandungan asamnya mampu mengurangi Manjakan Diri di Akhir Pekan Pijatan Tangan Kulit Sehat FOTO-FOTO: AHMAD ZAIMUL HAQ join follow @portalsurya
  • 13. 12 | GRESIKPLUS SABTU, 29 JUNI 2013 | mojokerto, surya - Sidang Banmus DPRD Kota Mojokerto terkait proses per- gantian antar waktu (PAW) Darwanto dari anggota DPRD Kota Mojokerto berjalan sangat alot dan sarat emosional. Mak- lum, kader Golkar yang kini meloncat pagar ke PDIPdikenal sosok berpengaruh. Dia adalah Ketua Yayasan Taman Siswa dengan banyak pendukung. Meski demikian, dalam Ban- mus yang digelar Jumat (28/6), anggota Fraksi Golkar ini dipu- tuskan di PAW sesuai regulasi. Padahal beberapa kali sidang yang sama gagal menghasilkan PAW atas dirinya. PAW-nya digelar 10 Juli nanti, kata ang- gota Banmus Joko Afriyanto. Baru kali ini, Rapat Banmus memenuhikuorum.Sebelumnya selalu gagal memenuhi batasan ini. PAW ini jawaban atas feno- mena banyak politisi jadi kutu loncat jelang Pileg. Darwanto dinilai bakal mampu memeng- aruhi perolehan suara partai. Sebenarnya selain Darwanto, Joko Afrianto sendiri masuk dalam daftar yang juga loncat partai. Namun surat keputusan (SK) pergantian Wakil Ketua Dewan asal Partai Demokrat ini belum diteken gubernur. Darwanto sendiri akan di- gantikan oleh Muhammad Bejo Edi Utomo. Kader Golkar ini raihan suaranya persis di ba- wah Darwanto di partai yang sama. Pengganti Darwanto ini tampak melihat langsung ja- lannya sidang Banmus. Apalagi dia mencium bahwa PAW-nya diolor-olor. Saya serahkan soal PAW ini pada fraksi dan mekanisme di dewan. Bagi saya, menggan- tikan anggota dewan di peng- ujung tugas tak masalah, kata Bejo. (fai) ktuban, surya - Empat anggota Badan Permusya- waratan Desa (BPD) terpilih Desa Mergosari, Kecamatan Singgahan Kabupaten Tuban melayangkan gugatan hukum ke Bupati Tuban, Fathul Huda. Keputusan hukum ini diambil setelah pemerintah menganulir hasil pemilihan para anggota BPD itu. Keempat anggota terpilih itu adalah Ahmad Syafi'i (41), Ali Sunarso (29), Samsul Hadi (47), dan Muhammad Soim (40). Kuasa Hukum keempat anggota BPD terpilih, Sujono Ali Muja- hidin mengatakan gugatan itu telah selesai dibuat dan telah di- daftarkan ke Pengadilan Negeri Tuban dengan nomor perkara 30/pdt/G/2013/PN Tuban. Kami menggugat Bupati Tuban, Camat Singgahan dan Panitia Pemilihan BPD Desa Mergosari karena tanpa alasan jelas tidak melantik BPD terpi- lih, kata Sujono, Jumat (28/6). Dalam gugatan tersebut, Su- jono juga menuntut ganti rugi hingga mencapai Rp 2 miliar. Pertimbangannya karena Pem- kab Tuban tak segera bereaksi setelah mendengar fakta atas terjadinya kekisruhan pemilihan BPD. Salah Alamat Kasubag Humas Pemkab Tuban ,Sulistiyadi berpenda- Kakek Pimpin Curi 50 Sapi lamongan, surya - Ka- kek berusia 63 tahun memimpin komplotan pencuri sekitar 50 ekor sapi di wilayah pantura La- mongan. Reju, sang kakek yang terpaksa ditembus timah panas tepat kaki kirinya dibekuk pe- tugas bersama tiga rekannya, Jumat (28/6). Reju tidak hanya memimpin satu komplotan saja, tapi dua kelompok. Terungkapnya kom- plotan Reju ini setelah petugas mengembangkan penyelidikan terkait seringnya sapi yang hilang di Paciran, Solokuro dan wilayah Panceng Gresik yang berbatasan dengan Lamongan. Dari kelompok pertama, petu- gas berhasil meringkus Reju (63) otak pencurian, Askan (40) seba- gai sopir, Katman (50) pengantar pelaku ke lokasari sasaran, keti- ganya warga Desa Payaman Ke- camatan Solokuro dan Sumarli (40) pemilik Colt L 300 nopol L 8350 CJ yang dipakai langganan membawa sapi hasil curian ke sejumlah Pasar Hewan. Sementara petugas masih me- ngembangkan penyelidikan un- tuk kelompok kedua yang juga pimpinan Reju. Beberapa nama yang disebut Reju diantaranya, Tk, Hk dan nama lainnya sudah dikantongi polisi. Kini sedang dikembangkan penyelidikannya untuk dapat meringkus tersang- ka kelompok dua ini. Saat pelaku dikonfirmasi, pelaku mengaku hanya mencuri enam kali dari sejumlah TKP. Aksi Reju dkk yang berlangsung dua tahun berjalan itu harus ber- akhir di balik jeruji besi tahanan polres setelah jejaknya berhasil dibongkar. Semua hasil curi- annya sudah dijual tak bersisa. Petugas menyita barang bukti uang tunai Rp 26 juta dari hasil pembagian penjualan dua ekor sapi yang terakhir, AKP Moch Umar Dhami, kata Kasubbag Humas Polres Lamongan. Harus Dua Ekor Kelihaian Mbah Rejo mencuri puluhan ekor sapi ternyata ada rahasianya. Pertama sasarannya adalah sapi yang dipelihara di kandang yang tempatnya di tegal, sawah jauh dari rumah pemiliknya. Syarat berikutnya, sapi yang dicuri harus lebiih dari seekor. Pokoknya harus curi dua ekor, karena kalau curi satu sapi, pasti ia akan melawan berontak,” aku Reju. Ternyata cara ini menjadi ra- hasia Reju dalam setiap aksinya hingga ulah nekatnya itu tidak pernah gagal. Cara lebih cepat menghilangkan jejak pencurian adalah setiap mencuri dilaku- kan jelang sehari di hari pasaran di Pasar Hewan Ngawi dan Jatirogo. Kasubbag Humas AKP Moch Umar Dhami meminta kepada warga di wilayah pantura yang kehilangan sapinya melaporkan kejadiannya ke polsek atau pol- res. Laporan ini akan memudah- kan petugas mengembangkan penyelidikan. (st36) surya/hanif manshuri pimpinan curi sapi- Reju (3 kanan) kakek usia 63 tahun, pimpin komplotan pencuri sapi saat ditahan di Mapolres Lamongan, Jumat (28/6). Reju punya cara jitu menyembunyikan sapi hasil curiannya agar tidak ketahuan. Ganti Legislatif Berlangsung Alot surya/adrianus adhi gugat bupati - Sujono Ali (kanan) usai ajukan gugat pada bupati Tuban Calon BPD Gugat Bupati Rp 2 Miliar Polisi Terpaksa Tembak Kaki Pelaku■ Polisi menangkap kakek bersama komplotan pencuri sapi Catatan polisi kakek sudah 50 kali mencuri sapi Kakek membantah, ia mengaku mencuri enam ekor sapi saja Kakek tahu cara menjinakkan sapi agar tidak memberontak saat dicuri ■ ■ ■ ■ storyhighlights gresik, surya - Jajaran Polres Gresik panen penang- kapan perkara judi toto gelap (Togel), Selama sepekan, seti- daknya 10 pelaku togel ditang- kap. Yang terbesar hasil tangkap- annya adalah Polsek Driyorejo lantaran mengamankan ban- dar togel, Tan Swi Chang (36), warga Surabaya. Ia diduga menjadi bandar togel di ling- kungan perusahaan PT WS, di Driyorejo, dengan omzet mencapai Rp 72 juta. Kanitreskrim Polsek Driyo- rejo AKP Tulus mengatakan penangkapan bandar togel itu bermula dari informasi ma- syarakat. Selanjutnya melalui teknik penyelidikan bisa me- nangkap basah bandar togel tersebut. Dari hasil pemerik- saan, tersangka Tan mengaku sehari pernah mendapatkan omzet Rp 1 juta, kata Tulus. Pembongkaran jaringan togel ini akan terus dilaku- kan di seluruh Gresik dan umumnya seluruh Jawa Ti- mur. Anggota Polsek akan kami kerahkan untuk mem- bongkar jaringan judi kelas teri maupun penjudi kelas kakap mulai menjelang bu- lan suci Ramadan. Selain itu juga atas instruksi Kapolda Jatim, bahwa Jatim harus bebas perjudian, tegas AKP Mohamad Nur Hidayat, Ka- sat Reskrim Polres Gresik. 10 Polsek BSelain Polsek Driyorejo, sembila polsek lainnya juga melaporkan penangkapan kasus judi. Polsek Kedamean mengamankan judi kartu de- ngan empat tersangka dengan barang bukti (BB) uang Rp 156 ribu; Polsek Gresik menangkap judi kartu, 5 tersangka dan BB Rp 195 ribu; Polsek Kebomas, mengamankan judi togel, 2 tersangka dan BB Rp 396 ribu; jajaran Polsek lain yaitu, Polsek Duduksampean meng- amankan judi domino dengan 3 tersangka dan BB uang Rp 30 ribu,PolsekCermemengaman- kan judi kartu, 4 tersangka, BB uang Rp 600 ribu, Polsek Ma- nyar menangkap penjudi kartu remi 3 tersangka dan BB uang Rp 43 ribu, Polsek Wringin- anom mengamankan penjudi kartu 5 tersangka, dengan BB uang Rp 340 ribu. Jajaran Satreskrim Polres Gresik mengamankan dua ka- sus penjudi kartu kyu-kyu de- ngan 3 tersangka, barang bukti uang Rp 1,3 Juta, tegas Hida- yat. (st38) Polres Gresik 'Panen' Penjudi Togel Polsek Tangkap Bandar Judi■ surya/fAI Darwanto pat gugatan para anggota BPD terpilih itu salah alamat. Seha- rusnya gugatan ke Pengadilan Tata Usaha Negara, bukan ke Pengadilan Negeri. Lagipula yang menganulir bukan bu- pati, melainkan panitia, tutur Sulistiyadi. Ia mengatakan gugatan itu merupakan salah satu bentuk kemajuan proses demokrasi masyarakat. Kami siap saja, itu adalah hak mereka, ujar Sulisti- yadi. (dri) ASMA adalah suatu keadaan di mana saluran nafas mengalami penyempitankarenahiperaktifit- as terhadap rangsangan tertentu, yangmenyebabkanperadangan. Penyempitan ini bersifat se- mentara. Pada penderita asma, penyempitan saluran pernafasan merupakan respon terhadap rangsangan yang pada paru-pa- ru normal tidak akan mempen- garuhi saluran pernafasan. Pe- nyempitan ini dapatdipicuoleh berbagai rangsa- ngan, seperti ser- buk sari, debu, bulu binatang, asap, udara di- ngin dan olah- raga. Kini, telah hadir Gentong Mas, minuman herbal dengan bahan utama Gula Aren dan Nigella Sativa (Habbatussauda) yang terbukti memiliki banyak manfaat untuk kesehatan. Salah satu manfaat herbal ini adalah untuk mencegah timbulnya serangan asma. Haryono, yang telah 15 tahun menderita asma adalah salah seorang yang telah merasakan manfaat herbal ini. “Sudah bertahun-tahun saya menderita asma yang disebabkan oleh alergi dingin. Kalau kambuh, mengganggu sekali rasanya... nafas sering terasa sesak, tim- bul batuk-batuk, dan perut jadi terasa mual. Untunglah sekarang saya tahu solusi yang paling tepat untuk mengatasi ke- luhannya, yakni dengan minum Gentong Mas. Setelah minum selama 7 bulan, sekarang sesak nafas sudah jarang kambuh, batuk dan mual pun berkurang.” Ungkap ayah 2 anak tersebut. Dengan tubuh yang sehat, war- ga Triwungan, Kec. Kotaanyar, Kab. Proboling- go, Jawa Timur ini pun dapat menjalani akti- fitasnya sebagai karyawan dengan prima. Ia pun tidak segan-segan membagi pengalamannya dengan orang lain, “Mudah-mudahan pen- galaman saya ini bermanfaat bagi yang lain.” Pungkas pria berusia 39 tahun tersebut. Histamin dalam Habbatus- sauda adalah sebuah zat yang dilepaskan oleh jaringan tubuh yang memberikan reaksi alergi seperti pada asma bronchial. Habbatussauda dapat men- gisolasi ditymoquinone, yang berdampak positif terhadap pen- derita asma bronchial. Ascorbic Acid, Thymohydroquinone dan Linoleic Acid pada Gentong Mas berfungsisebagai anti-hista- min dan anti-asthma. Selain itu, Gentong Mas juga mengandung Nigellone yang berfungsi mem- perbaiki saluran pernafasan atau anti-bronchitis. Nigela sativa yang ada pada Gentong Mas mengandung Nigellone (zat anti bronchitis) dan Linoleic acid (zat anti-histamin) yang berfungsi mencegah alergi. Sementara Gula Aren ba- nyak mengandung nutrisi yang dibutuhkan tubuh diantaran- ya seperti Riboflavin, Niacin, Ascorbic Acid, Kalsium dan lain-lain. Riboflavin membantu pembentukan antibodi, mem- bantu terbentuknya energi, memperbaiki kerusakan sel saat proses produksi energi, dan memperbaiki jaringan sistem pencernaan. Sekarang Gen- tong Mas mudah diperoleh di pasaran. Dan semakin banyak masyarakat yang merasakan sendiri manfaat Gentong Mas, sehingga tingkat permintaan juga selalu meningkat secara signifikan. Untuk informasi lebih lan- jut silahkan kunjungi www. Bagi Anda yang membutuh- kan Gentong Mas bisa didapat- kan di apotek/ toko obat terdekat atau hubungi: 14047. (ikl) ANDA pasti sudah pernah mera- sakan manisnya madu. Tapi tahu- kah Anda khasiat apa saja yang terkandung di dalamnya? Selain meredakan batuk dan membuat tidur lebih tenang, berikut adalah beberapa khasiat madu yang me- ngagumkan. 1. Mengkonsumsi madu mam- pu meningkatkan antioksidan dalam darah dan mampu me- ningkatkan penyerapan kalsium oleh tubuh. 2. Madu bekerja sebagai anti- biotik alami yang sanggup men- galahkan bakteri mematikan. Kan- dungan alami madu berupa hidro- gen perioksida yang diproduksi dari enzim lebah diduga bekerja seperti antibiotika alami sehingga punya daya menyembuhkan. 3. Madu dapat meningkatkan kekebalan tubuh karena sangat kaya akan polifenol, jenis antiok- sidan yang membantu melindungi sel dari kerusakan radikal bebas. 4. Madu memang dikenal se- bagai sumber energi paling alami dan bisa juga sebagai pengganti karbohidrat yang digunakan pada saat berolahraga. 5. Madu berkhasiat untuk ke- cantikan. Minum madu atau mengoleskan madu pada bagian tubuh bisa mengusir gangguan ku- lit, seperti jerawat dan gatal-gatal. Cegah Asma dengan Cara Alami Madu Menyehatkan TERSEDIADIAPOTIKDANTOKOOBATTERDEKAT Informasi Pemasangan Iklan Hubungi : Hakim - 0812345 94787 | Meidy - 031 83356990 PENGABDIAN Yayasan Pen- didikan IPIEMS didunia pen- didikan sejak tahun 1968 tidak perlu diragukan lagi karena selalu berusaha untuk mencapai kualitas pendidikan yang cemerlang mampu membangun generasi yang berkualitas, cerdas, dan beri- man sesuai keinginan ma- syarakat, bangsa dan Negara. Bagi Siswa SD yang mendaftar ke SMP IPIEMS dengan danem (lebih besar sama dengan) 22 mendapat keringanan sumbangan pem- bangunan Rp. 500.000 dari Rp. 1.000.000. Bagi siswa SMP yang mendaftar ke SMA, SMK IPIEMS sumbangan pem- bangunan masing –masing sebesar Rp. 1,2 juta dan 1,65 juta bisa diangsur 4 kali. SMA IPIEMS ++, kuliah oke, kerja pun oke, memiliki beberapa keunggulan : Ada 17 kegiatan pengem- bangan diri (ekstrakurikul- er) antara lain broadcast, band, cheerleader, jurnalis, PMR, futsal, bahasa jepang dan Mandarin, volley, bas- ket, desain grafis, pencak silat, paskibra, tari tradis- ional dan modern. Setelah Lulus mendapat sertifikasi bahasa Inggris Toefl. Tersedia laboratorium com- puter dan fasilitas internet, laboratorium bahasa, labo- ratorium fisika, biologi, kimia. Sarana informasi sekolah (Tele-School dan Website). Area Wi-fi (Free Internet). Sekolah Kreatif SMK IPIEMS Membuka jurusan MULTI- MEDIA (MM) dan DESAIN GRAFIS / DESAIN KOMUNI- KASIVISUAL (DKV). Sekolah kreatif SMK IPIEMS berupaya mencetak siswa yang kreatif sesuai dengan tuntutan era saat ini, yakni era industry kre- atif. Kegiatan yang dilakukan sekolah kreatif SMK IPIEMS adalah : Menyiapkan SDM profes- sional. Tenaga pengajar sekolah kreatif SMK IPIEMS adalah guru muda yang kreatif dan inovatif dan fresh graduate dari pergu- ruan ternama di Indonesia. Fasilitas pengembangan diri/ekstrakurikuler an- tara lain ; Basket, futsal, cheerleader, kreatifitas, English club, PMR, ORI (SKI/Baca tulis Al-Qur’an), tari, paskibra, Robotic dan Broadcasting. Sekolah tradisi juara SMP IPIEMS : Memberikan layanan gratis kepada siswa SMP IPIEMS dalam bidang pelajaran computer, ulangan sumatif. Adapun kegiatan pengem- bangan diri antara lain : Agama dan Olah raga futsal, Bola Volley, Basket, Dance, Silat, KIR (Karya Ilmiah Remaja), Paduan Suara, Vokal Band, Ele- ktronika. Peningkatan sarana dan prasarana seperti buku perpustakaan, laborato- rium, dan sarana ruang kelas ber-AC. Mengkhususkan pening- katan kemampuan siswa dalam pelajaran matema- tika dan bahasa Inggris sejak kelas VII. Prestasi Ipiems : Pemecahan Rekor Muri, PembuatanWedha PopArt Potrait (WPAP) terbanyak di Indonesia Tahun 2013. Juara II LPIR Tingkat Na- sional. Juara II lomba menulis artikel festival ekonomi kreatif SMA sederajat se- Indonesia. Juara III Kompetisi Film Pendek Kidsffest Tingkat Internasional di Jakarta tahun 2013. Juara I Festival Film Pelajar Surabaya 2013.(ikl) Mulai11Juni2013SampaidenganTargetTerpenuhi Pendaftaran Siswa Baru SMP, SMA, SMK IPIEMS Sekretariat Pendaftaran SMP, SMA, SMK IPIEMS Jl. Raya Menur No. 125, Surabaya Telp. SMA IPIEMS (031) 5993014, Fax. (031) 5947930 Telp. SMK IPIEMS - (031) 5949790 Telp. SMP IPIEMS - (031) 5923769 Penyerahan Rekor Muri WPAP Tahun 2013. join follow @portalsurya
  • 14. | | SABTU, 29 JUNI 2013 HOTLINEPUBLICSERVICE MOH KHOLIDUN Mahasiswa STAI Al-Khoziny Buduran-Sidoarjo TELEVISI merupakan media yang sangat berpengaruh kepada semua kalangan. Baik dewasa, remaja bahkan anak-anak. Puluhan program ditayangkan untuk menarik perhatian publik. Mulai dari program film, musik, olahraga, berita, komedi, dan sebagainya. Salah satu program sinetron di sebuah televisi swasta ini bisa jadi tidak sekadar tontonan, namun bisa dijadikan tuntutan. Sinetron Pesantren Rock n Roll season 3 ini contohnya. Si- netron ini bisa dibilang menja- di langganan kami sekeluarga. Bila tiba waktunya kami duduk manis di depan layar kaca siap menyimaknya. Tayangan yang menyuguhkan kehidupan di pondok pesantren ini banyak menyisipkan pesan moral dalam alur kisahnya yang dike- mas lucu, mengge- maskan, dan mendidik lewat tokoh- tokohnya. Ada Najib Maghrib yang di- perankan Ramzi, Bejo (Ferry Gus- tian), Nada (Aulia Sarah) dan artis-artis muda lainnya, seper- ti Rizky Nazar (Wahyu Subuh Junior), Rizky Alatas (Ashar Maghrib) dan Dinda Kirana (Nayla). Tak ketinggalan ustad dan ustadzah yang puisi serta tausyiahnya yang berbobot patut diacungi jempol. Ustadzah Ummi Qanita (Luluk) misalnya, dalam epi- sodenya membahas tentang aqidah. Menanamkan aqidah dengan kalimat laailaha illallah sebaiknya diajarkan kepada anak sejak dini. Sebagaimana diriwayatkan Ibnu Hakim dari Ibnu Abbas bahwa Nabi SAW bersab- da, “ajarkan kalimat laai- laha illallah kepada anak- anak kalian sebagai kali- mat pertama dan tuntun- lah mereka mengucap- kan kalimat laailaha illallah ketika menjelang mati.” Ustad- zah juga memaparkan aqidah menurut fase Ali bin Abi Thalib, bahwa menanamkan aqidah kepada anak dimulai sejak usia tujuh tahun. Setelah usia itu hingga 14 tahun anak dididik dengan disiplin. Di usia 14 tahun hing- ga 21 tahun ke atas anak diajari dengan metode bersahabat, ujarnya. Di samping itu memberikan nama-nama yang baik juga perlu. Misalnya, perempuan dengan awalan Siti, laki-laki dengan awalan Muhammad, Achmad, dan seterusnya. Pada hakekatnya menanam- kan aqidah kepada anak tak harus menunggu dewasa. Akan tetapi sejak ia masih dalam kandungan ibunya. Nah, dari sini sudah jelas, bahwa peran orangtua sangat penting dalam mendidik anaknya. Sudahkah Anda mempraktikkannya? (http://surabaya.tribunnews. com/2013/06/28/tontonan- dan-tuntunan) OLAHAN makanan berbahan dasar durian kini semakin beragam, mulai dari minuman hingga cemilan. Satria durian adalah salah satu depot spesialis penjaja makanan dan minuman berbahan dasar durian. Salah satu olahan favorit di depot satria durian yang paling banyak dicari penikmat durian adalah es degan durian, selain ketan durian, dengan harga relatif terjangkau, mulai dari Rp 10.000. Bu Satria, pemilik depot satria durian mengaku, durian yang dipakai di depot ini bukan durian sembarangan karena akan berpengaruh pada citarasa olahannya. Durian montong menjadi pilihan- nya, di mana durian jenis ini didapatkannya langsung dari si pemilik kebun. Depot yang setiap hari membuka kedai di lantai empat Tunjungan Plasa (TP) 1 itu dirintis sejak tahun 1999 silam bisa dibilang menjadi jujugan bagi para pecinta durian. Maklum, tanpa harus repot-repot berburu atau mengolahnya terlebih dulu, minuman dan cemilan durian mudah ditemukan di sana. Kendati mudah didapatkan, durian dengan citarasa berbe- da ini tentu tidak semestinya dikudap setiap hari karena berbagai alasan, salah satunya pertimbangan kesehatan. Nah, kini Anda bisa setiap saat mendapatkan durian tan- pa menunggu musim durian bukan? (http://surabaya.tribunnews. com/2013/06/28/satria- durian) IKLAN HP Cross begitu prestisius se- hingga membuat saya tergiur. Dengan pertimbangan harga, spesifikasi, kualitas layar, model HP yang tak memalukan, dan setelah membandingkan dengan HP lain, pada 12 Juni 2013 saya membeli HP Cross a7s. Baru 10 hari menikmati, HP Cross a7s sudah error dan tak berfungsi dengan baik. Karena masih ada garansi saya ke BG Junction (setelah searching di web karena dalam kartu garansi tidak ada alamat servis center Cross), sementara nomor telepon tak ada yang mengang- kat. Ternyata SC Cross pindah ke Kayon 20 Surabaya. Di sana antrean lumayan banyak. Gi- liran saya ke SC, HP Cross a7s mendadak aktif meski tetap belum berfungsi mak- simal. Saat saya tanya kenapa? SC dan petugas di room servis mengakan bila HP harus ditinggal sekitar satu minggu untuk pembenahan softwarenya. Meski kecewa karena lamanya layanan SC Cross, HP akhirnya saya tinggal. Gencarnya iklan Cross yang prestisius seharusnya diikuti dengan layanan pur- najual andal. Belajar dari pengalaman, banyak customer kapok gara-gara kuali- tas purnajual yang kurang oke. Semoga ini bisa menjadi catatan penting agar Cross menjadi perusahaan seprestisius iklannya. Muhammad Rizal Wonocolo 7/12 Surabaya (http://surabaya.tribunnews. com/2013/06/28/hp-cross-tak- sebagus-iklannya) HP Cross Tak Sebagus Iklannya Tontonan dan Tuntunan Tidak harus menunggu musim durian tiba, satria durian adalah jawaban bagi pecinta berat durian untuk sekadar mencicipi buah ini. SUARA PUBLIK Anda punya keluhan atau pendapat terkait pelayanan umum? Jangan pendam sendiri. Anda punya hak untuk bersuara. Kirim SMS ke 083 831 686 299 083 857 517 888 KUPU KUPU EKS TERMINAL GADANG - Kpd Dinas trkait d kota malang, kami mghrp utk mentrtibkan lahan eks. trmnal gdang mlg krn stiap mlm mnjdi tmpt para waria dan psk.mngingat sbntr lg kita mnyambut bulan suci Ramadhan,dan km mghrp pihaktrkait jg mntrtibkan tempt kos d sblh utara eks. trminal Gdang khusus d wilyah Rw.4,krn km meliht slm ini,d slh gunakan utk. Tmpt mesum dan Kmpul kebo..ats prhatianya km ucpkan Trm ksh. 628578663xxxx JALUR ALTERNTIF PLOSO SELOPURO - Pak bupati bltr ,sdh wktnya per baikan jalan tembus jalur alternatif mbambang pos sampai ploso selopuro bltr ,byk lubang ditanami pohon pisang oleh warga. 628213178xxx PENGADUAN PLN PANDAAN - Pelayanan pengaduan d pln pandaan pasuruan sangat mengecewakan dan tdk layak untuk d sebut pelayanan konsumen .pasalnya yg menunggu loket orang- nya tdk tahu tentang pln orangnya tdk profesional dan arogan .mohon kepala pln pandaan menindak lanjuti. 628155577xxxx LELETNYA JEMBATAN BRANJANGAN - Kpd yg trhrmat ibu wali kota sby.....Kapan ya jmbtn brnjngan selesainya sy tiap hari krja pp gresik srby sering kena antre macet di sana, sdh bosan rasanya tiap hari hrs antri dan kena macet krn msh blm slsainya jmbtn trsbt, mhn kpd bu wali agar di prcpt pkrjaannya kl g slh ini udh brjln satu stngh tahun, mngkn ini sy mewakili semua pngnda- ra yg tiap hari lewat sana......tlng ya bu....Thanks. 628194989xxxx E-KTP NGADILUWIH KEDIRI - yth bpk camat ngadiluwih,kpn komputernya bisa di program untuk nrima nama yg ada kom- anya..sudah dua kali saya foto ektp tp blm bisa,kata pegawainya komputernya memang gk bisa nrima titik dan koma,trus gmn pak,dan sampei kpn?trima kasih. 628573006xxxx DENDA PEMBUANG SAMPAH - yth wali kota Kediri mhn dibuat aturan tegas seperti denda unt masyarakat yg suka buang sam- pah ke sungai. Untuk pembuktian bekerjasamalah dg komunitas fotografi untuk membidik mereka yg msh suka buang sampah ke sungai atau yg bukan tempat sampah. 628564919xxxx BALAP LIAR MBANTER - unt aparat kepolisian mhon menindak tegas anak-2 bau kencur yg balap liar di jembatan Mbanter Tu- lungagung, krn selain mengganggu warga dan pengguna jalan, jg sangat berbahaya bg keselamatan mereka. 628578435xxxx LAMPU BELAKANG R2 - unt aparat kepolisian mhn bs bersikap tegas dengan menertibkan lampu R2 belakang warna putih krn sngt mengganggu pengendara di belakangnya sering memicu laka. 628385623xxxx JEMBATAN WATES KEDIRI - untk dinas trkait mohon perhatian utk segera diadakan prbaikn jembtn di selatan pasar Wates- Kediri, krn sangat mempengaruhi aktivitas ekonomi warga. 62856352xxxx MENANGGAPI keluhan bapak Arso Yudianto menge- nai layanan di RSI Jemursari Surabaya (Harian Surya 26 Juni 2013), manajemen RSI Jemursari Surabaya telah bersilaturahim dengan bapak Arso Yudianto sekeluarga. Manajemen berterima kasih untuk masukan yang telah diberikan Bapak Arso Yudi- anto. Insyaallah manajemen akan berupaya meningkatkan pelayanan agar senantiasa dapat memberikan pelayanan terbaik kepada pelanggan. Dan, mohon maaf untuk ketidaknyamanan yang bapak alami selama di RSI Jemursari Surabaya. Dra Siti Yatimah Ak MKes Manajemen RSI Jemursari Surabaya (http://surabaya.tribunnews. com/2013/06/25/layanan-poli- kandungan-rsi- jemursari) Layanan RSI Jemursari Punya masalah dengan layanan publik, dari gangguan telepon, listrik, air, pajak, parkir, dan layanan umum lainnya? Kirim ke Harian Surya, lengkapi identitas diri dan nomor kontak yang mudah dihubungi. Jl Rungkut Industri III No 68 70 Surabaya FAKSIMIL: 031-8414024 SURAT : EMAIL : citizen reporter Liput dan tulis sendiri pengalaman atau acara Anda sepanjang 450 kata, lengkapi identitas diri, nomor kontak, dan pas foto diri terbaru. Email ke Satria Durian SURYA/AHMAD ZAIMUL HAQ SAMPAH PANTAI NAMBANGAN - Sampah memenuhi pantai Nambangan, Kedung Cowek, Surabaya Timur, Kamis (27/6), menjadikan kondisi pantai jauh dari indah. YUNIA SURYA KUSUMAWARDHANI SEMUA WARTAWAN SURYA DIBEKALI TANDA PENGENAL DAN TIDAK DIPERKENANKAN MENERIMA / MEMINTA APA PUN DARI NARASUMBER. Setiap artikel/tulisan/foto atau materi apa pun yang telah dimuat di Harian Surya dapat diumumkan/dialihwujudkan kembali dalam format digital maupun nondigital yang tetap merupakan bagian dari Harian Surya. HARIAN PAGI Staf Redaksi: Satwika Rumeksa, Tri Yulianto, D Wahjoe Harjanto, Trihatmaningsih, Tri Dayaning Reviati, Eko Supriyanto, Hariyanto, Tri Mulyono, Tutug Pamorkaton, Wahyudi Hari Widodo, Endah Imawati,Yuli Ahmada, M Rudy Hartono, Ahmad Pramudito, Anas Miftahudin, Joko Hari Nugroho, Wiwit Purwanto, Suyanto, Deddy Sukma, Habiburrohman, Adi Agus Santoso, Titis Jatipermata, Fatkhul Alami, Doso Priyanto, Dyan Rekohadi, Sri Handi Lestari, Marta Nurfaidah, Sugiharto, Musahadah, Mujib Anwar, Ahmad Zaimul Haq, Aji Bramastra, Nuraini Faiq, Adrianus Adhi Nugroho, Eko Darmoko, Haorrahman Dwi Saputra, Muhammad Miftah Faridl, Ahmad Amru Muis, Sudarma Adi; Ilustrator: Rendra Kurniawan, Akhmad Yusuf Marzuki; Perwajahan: Teguh Wahyudi, Edy Minto Prasaro, Agus Susanto, Haryoto, Njono, Anang Dwi H, Aloma Irjianto General Manager Business: Agus Nugroho; Wakil General Manager Busines: M Taufiq Zuhdi ; Manager Iklan: Shinta Indahayati; Manager Business Development: Prasetiyo; Biro/Perwakilan: Malang: Hesti Kristanti, Wahyu Nurdiyanto, Eko Nurcahyo, Sylvianita Widyawati, Iksan Fauzi Alamat: Jl Sultan Agung No. 4, Malang. Telepon: (0341) 360201 Fax: (0341) 360204. Iklan: fax (0341) 360204, Sirkulasi (0341) 360203, Kediri: Didik Mashudi, Madiun: Imam Hidayat, Jakarta: Ravianto, Alamat: Jl Palmerah Selatan 12 Tlp (021) 5483008, Fax: (021) 5495360 Kantor Pusat: Jl Rungkut Industri III No 68 70 Surabaya 60293 Telepon: (031) 8419000, Fax Redaksi: (031) 8414024 Alamat Surat: PO BOX 110 SBS 60400 Surabaya Penerbit: PT Antar Surya Jaya, Surat Izin Usaha Penerbitan Pers: SK Menpen No.202/ SK/MENPEN/ SIUPP/A.7/1986 Tanggal 28 Juni 1986. Percetakan: PT Antar Surya Jaya. Isi di luar tanggung jawab percetakan. Tarif Iklan: Iklan taktis 1 Karakter Rp 1.000 (minimal 2 baris); Iklan display/ umum (hitam putih) Rp 35.000/mmk, Iklan display/umum (warna) Rp 45.000/ mmk; Iklan duka cita Rp 4.000/mmk (hitam putih); Iklan mendesak/duka cita untuk dimuat besok dapat diterima sampai pukul 15.00 WIB. Bagian Iklan: Jl Rungkut Industri III No 68 70 Surabaya 60293, Telepon: (031) 841 9000, Fax: (031) 8470000 dan (031) 8470500. Perwakilan Iklan Jakarta: Gedung PT Indopersda Primamedia, Jl Palmerah Selatan No.3 Jakarta. Telepon (021) 5483863, 54895395, 5494999, 5301991 Fax : (021) 5495360. Bagian Sirkulasi (Langganan): Gedung Kompas Gramedia Jl. Jemur Sari No. 64 Surabaya, Telepon: (031) 8479555 (Pelanggan/Pengaduan), (031) 8483939, 8483500 (Bagian Sirkulasi) Fax: (031)8479595 - 8478753. Harga Langganan Rp 29.000/bulan, Rekening: BCA Cabang Darmo, Rek 088- 3990380; Bank BNI Cabang Pemuda, Rek. 0290-11969-3 (untuk iklan); Bank Mandiri Cabang Rungkut, Rek 141-00-1071877-3 (untuk sirkulasi) atas nama PT Antar Surya Media. Surya Online: E-Mail: PEMIMPIN UMUM : H Herman Darmo PEMIMPIN REDAKSI : Febby Mahendra Putra WAKIL PEMIMPIN REDAKSI : Farhan Effendy SEKRETARIS REDAKSI : P Sujarwanto MANAJER PRODUKSI: Adi Sasono MANAJER LIPUTAN: Sigit Sugiharto Foto-foto Citizen Photos join follow @portalsurya
  • 15. Travelling | Panggilan Journalism Travelling E mpatpendakipesertaJournalismTra- vellingmenjawabtantangandaripanitia TamanNasionalBromoTenggerSemeru (TNBTS)dengan10personeldariBadan PerencanaandanPembangunanNasional (Bappenas)menapakiGunungSemeru,awal Juni.Persiapanperbekalansudahready.Mental yangmasihharusdiasah.Maklum,pendaki- anterakhiryangdilakukansekiantahunlalu ketikakaki-kakimudamasihtangguh. Sebelum menapaki puncak, Selasa (4/6), pukul 06.00 rombongan berjalan dari Desa Ranu Pani, Kecamatan Seduro, Kabupaten Lumajang. Daratan itu berada 2.100 meter di atas permukaan laut (mdpl). Selama hampir lima jam, jarak 10,5 km hingga Ranu Kumbolo (2.390 mdpl) ditempuh. Di tempat inilah segala lelah sirna. Ini lokasi yang biasa menjadi persinggahan pendaki pemula. Jika tidak ingin mencapai Mahameru yang menjadi puncak Gunung Semeru, Ranu Kumbolo adalah lokasi terbaik. Beberapa rombongan memilih menghabiskan waktu di situ saja. PendakiyangberniatmencapaiMahameru tidakbolehterlalulamamenikmatikemolekan itukarenaharussegerakeKalimati(2.700 mdpl).Jarak7,5kmharusditempuhhampir limajam.Maklum,kakisudahtidakterbiasa menapak.Dikota,selaluadakendaraan yangmelenakan.Lamaperjalananitukarena tanjakanterjalyangharusdilalui. Perhentian di Kalimati membuat merin- ding karena di sepanjang jalan ada banyak nisan. Itu makam para pendaki yang dijemput maut. Tidak sembarang obrolan atau candaan boleh keluar dari mulut ketika menginjakkan kaki di kawasan itu. Tokoh masyarakat serta Kepala Bidang Pengelolaan Taman Nasional Wilayah II Lumajang, Sucipto, telah memberikan pesan. “Mohon menjaga canda di kawasan ini. Konon, di kawasan ini angker. Sudah banyak kejadian aneh-aneh di sini,” ujar Sucipto ketika di Ranu Pani. Nisan-nisan itu mengingatkan setiap pendaki untuk pantang menyerah sekaligus tidak sombong. Perjalanan dilanjutkan tanpa suara hingga di Kalimati pukul 20.30. Puncak Tinggal Selangkah Pukul 23.00 panitia membangunkan semua pendaki. Puncak Mahameru tinggal 2,7 km. Meski jarak tampak pendek, perjuangan mencapainya tidak mudah. “Jangan lupa bekal, air minum, ma- kanan ringan, senter disiapkan,” suara Yohanes Cahyo, Kepala Resort Ranu Pani di kegelapan. Sebelum berangkat, Kepala Balai Besar TNBTS, Ayu Dewi Utari, memimpin doa agar semua yang ikut mendaki hingga puncak bisa selamat dan kembali pulang bersama. Usai berdoa, pukul 23.30 saat suhu udara 8 derajat, peserta berangkat. Jalan yang dilalui tak mudah. Kawasan hutan cemara dengan jurang di kanan atau kiri sama sekali tidak menyisakan bonus jalan datar. Sekitar pukul 02.00, peserta tiba di Arcopodo (2.800 mdpl). Ada waktu rehat sejenak untuk menghela napas ditemani sebuah nisan pendaki. Sebagian pendaki tidak kuat dan memilih turun kembali ke Kalimati. Hanya 16 peserta yang melanjutkan perjalanan ke puncak. Jalan semakin berat setelah melewati batas vegetasi cemoro tunggal, jalanan berpasir, dan berbatu. Dari Arcopodo, puncak masih 1,5 km lagi. Sulitnya medan berpasir ini memaksa para pendaki yang tidak kuat untuk merangkak. Pukul03.00,pendakimendekatipuncak. Kendalabesaradalahsemakinmenipisnya oksigen.Rasakantuktaktertahankan.Jika lelah,sesekalibisamembaringkanbadandi ataspasirdengankemiringancuramsembari menikmatigemerlapjutaanbintangdilangit. Namun, jangan sampai tertidur. Jika tidur, perjalanan akan semakin berat. Memulihkan tenaga butuh waktu. Pilihan paling tepat adalah menahan kantuk dan kosentrasi melanjutkan perjalanan. Pukul 05.00, puncak Semeru sudah terlihat. Mega merah mulai tampak. Namun, matahari masih bersembunyi di balik awan yang sedang mendung. Sunrise pun gagal dinikmati. Saat langit mulai terang, rasanya seperti berada di negeri di atas awan. Akhirnya, setelah menempuh perjalanan selama tujuh jam, pukul 06.30 titik nol Mahameru bisa terinjak. Kelelahan terobati setelah melihat sekitar Mahameru. Di bawah puncak itu, terlihat awan putih seperti kapas halus bergelombang hampir mengelilingi puncak. Dari jauh, terlihat Gunung Bromo dan Gunung Arjuno berlatar belakang langit biru. Di balik jalur pendakian, terdengar aktivitas vulkanik dari kawah Jonggring Saloko. Setiap 20 menit, kawah itu menge- luarkan kepulan asap dan dimanfaatkan sebagai latar belakang oleh pendaki untuk berfoto sebagai bukti pernah menginjak- kan kaki di Mahameru. Pukul 08.30 angin mulai membawa asap dari kawah ke arah puncak Semeru. Asap itu berbahaya. Tidak ada waktu lagi untuk menikmati negeri di awan. Semua harus segera meluncur turun. Menuruni puncak Semeru hanya membutuhkan waktu tiga jam. Setelah ber- henti sejenak sambil menghitung peserta, perjalanan berlanjut ke Ranu Pani. Salah seorang tim SAR Lumajang, Sugiyono, mengingatkan bahwa pendaki berangkat bersama, pulang pun harus bersama. “Hilangnya pendaki bisanya disebabkan faktor kelelahan saat turun dari puncak sehingga mengalami disorien- tasi akhirnya kebanyakan nyasar ke blank 75,” kata Sugiyono. Puncak Mahameru memberi pesona dan petualangan. Perlu persiapan fisik jika ingin menikmati petualangan di jalur Semeru. (iksan fauzi) GunungSemeruMenjadiGunungSampah S elama perjalanan mendaki maupun menuruni Semeru, ada banyak pendaki dari berbagai daerah. Mereka rata-rata adalah pendaki pemula yang ingin menapaki jalanan di Semeru itu berkat film 5 Cm yang diproduksi PT Soraya Intercine Films. Salah satu mahasiswi asal Malang, Linda mengaku da- tang ke Semeru setelah menonton film 5 Cm. Linda yang mengaku baru pertama ke Semeru itu tidak mengguna- kan peralatan pendakian yang memadai. Ia mengenakan celana jeans serta bersepatu yang biasa untuk ke mal. “Ini ke Semeru baru pertama setelah melihat film 5 Cm. Saya tidak cari info lain tentang Semeru,” katanya. Catatan Taman Nasional Bromo Tengger Semeru (TNBTS), setiap akhir pekan, setidaknya ada 3.000 pendaki yang datang ke Semeru. Film 5 Cm menjadi magnet besar untuk mendongkrak pengunjung. Namun, banyaknya pengunjung itu juga membuat masalah baru. Masalah utama tidak lain adalah sampah. Mulai dari Ranu Pani hingga puncak Semeru bertebaran sampah plastik yang membuat pemandangan terusik. Sampah- sampah itu nyaris terdapat di setiap pos. Sayangnya, TNBTS tidak menyediakan bak sampah di setiap pos. Bak sampah hanya terlihat di pos Ranu Kumbolo. “Masalah ini harus segera dibenahi, mengingat TNBTS merupakan wilayah konservasi,” kata Hadi Suyitno, Kepala Seksi TNBTS Wilayah III. Untuk mengatasi sampah ini, TNBTS menggandeng masyarakat setempat. Tidak lama ini, masyarakat me- ngumpulkan satu truk sampah plastik. Saat ini, sampah- sampah itu masih belum dimanfaatkan untuk kerajinan tangan, hanya dijual kiloan. Menurut Hadi, ada rencana TNBTS menerapkan sistem jaminan sampah berupa uang sebesar Rp 5.000/ kg kepada para pengunjung di pos penjagaan masuk. Penerapan ini mencontoh pengelolaan taman nasional di Gunung Rinjani. Hal itu bertujuan supaya pengunjung membawa pulang sampah yang dibawanya. Jika sampah yang dibawa pulang kurang dari yang seperti awal masuk, maka TNBTS akan menyita uang jaminan tersebut. “Kalau pecinta alam senior tahu, sementara pendaki pemula ini yang sering membuang sampah sembarang- an,” ujarnya. Membeludaknya pengunjung ke Semeru membuat TNBTS mencari solusi lain supaya tidak terjadi keru- wetan di tempat transit, seperti Ranu Kumbolo maupun Kalimati. Kepala Balai Besar TNBTS, Ayu Dewi Utari, bakal menerapkan sistem pemesanan kunjungan melalui online. “Pemesanan online mulai jalan, tetapi belum sempurna. Tanpa booking online juga masih bisa,” katanya. Tujuan sistem ini adalah untuk menata jumlah peng- unjung. “Nanti, ada pembatasan usia juga, minimal 10 tahun dan semua pengunjung harus mengantongi surat dokter,” paparnya. (iks) HALAMAN 14 | | SABTU, 29 JUNI 2013 Semeru dari Puncak Efek film 5 Cm memang dahsyat. Gunung Semeru menjadi daya tarik bagi pendaki pemula. Sayang, banyak pendaki tidak menyiapkan diri sehingga pendakian hanya mendatangkan sengsara. Ranu Kumbolo menjadi tempat wisata yang dapat dinikmati bersama keluarga, jika tidak ingin mencapai Mahameru. ■ Perlu persiapan fisik untuk menghadapi segala kemungkinan di alam terbuka. Jangan meninggalkan sampah. ■ ■ story highlights FOTO-FOTO: surya/IKSAN FAUZI join follow @portalsurya
  • 16. | SURABAYALINES| SABTU, 29 JUNI 2013 SURYA/TRI DAYANING REVIATI Kunjungan - PR and Media Dept PT Arga Mas Lestari, penge- lola merek Advan, Dara Ayuningtyas (kiri) dan Business Executive Manager PT Intech Surya Abadi, Lukie Lukman Hakim, menyerahkan suvenir kepada Wakil GM Business Harian Surya, M Taufik Zuhdi (kanan) saat berkunjung ke Redaksi Surya, Jumat (28/6). SURABAYA, surya - Calon mahasiswa baru dari jalur ke- mitraan dan mandiri diwajibkan membayar uang sumbangan pe- ngembangan pelayanan pendi- dikan (SP3) atau yang biasa di- sebut uang gedung. Sistem uang kuliah tunggal (UKT) hanya berlaku bagi mahasiswa baru dari jalur seleksi masuk nasional (SNMPTN dan SBMPTN). Di Universitas Airlangga (Unair), SP3 telah berganti se- butan menjadi uang kuliah awal (UKA) bagi pendaftar dalam negeri. Sementara pendaftar berwarga negara asing istilah- nya tetap SP3. Sedangkan di ITS bernama sum- bangan pengembangan institusi (SPI). UKA Unair cukup tinggi di- bandingkanrata-ratadiITS. UKA terbesar tetap dipegang jurusan Pendidikan Dokter, yakni Rp 70.000 juta. Disusul ke- mudian Pendidikan Dokter Gigi Rp 60.000 juta dan Kedokteran Hewan Rp 50.000 juta. Untuk pendaftar luar negeri, UKA (SP3) ini semakin berlipat. Untuk Pendidikan Dokter, war- ga asing dikenakan SP3 Rp 250 juta dan Pendidikan Dokter Gigi sebesar Rp 175.000 juta. Sementara di ITS nilai SPI ber- kisar antara Rp 20 juta hingga Rp 45 juta. SPI Rp 45 juta berla- ku untuk delapan jurusan yakni Teknik Elektro, Teknik Industri, Manajemen Bisnis, Teknik Mul- timedia dan Jaringan, Teknik Si- pil, Teknik Lingkungan, Teknik Informasi dan Sistem Informasi. Sementara untuk uang kuliah (UK) yang dibayar per semester di Unair besarannya bervariasi di tiap-tiap program studi. Biaya terbesar tetap Pendidikan Dok- ter sebesar Rp 15.000 juta per semester, kemudian Pendidikan Dokter Gigi Rp 12.500 juta dan Kedokteran Hewan Rp 7,5 juta per semester. Sementara di ITS besaran uang kuliah jalur kemitraan dan mandiri menganut nilai UKT tertinggi yakni Rp 7,5 juta per semester untuk semua program studi,kecualiproditekniksistem perkapalan double degree sebesar Rp 19,7 juta per semester. Wakil Rektor II Unair, M Nasih mengatakan, UK dan UKA yang harus dibayar calon mahasiswa tidak bisa kurang maupun lebih. ”Kelulusan tetap didasarkan pada hasil ujian saja. Tidak ada kaitannya dengan kesanggupan membayar,” tegas Nasih, Jumat (28/6). Seleksi jalur mandiri Unair akan digelar 7 Juli 2013. Terdiri tes potensi akademik (kemam- puan verbal, numerik dan pe- nalaran), tes prestasi akademik yang dibagi dalam kelompok IPA, PS dan IPC. Hal ini berbeda dengan ITS yang mendasarkan seleksi pada hasil nilai SBMPN. Karena itu pendaftar jalur mandiri ITS harus lebih dulu mengikuti SBMPTN. Kepala Bagian Akademik ITS Ismaini Zain mengungkapkan, kelulusan jalur mandiri ini dida- sarkan pada hasil tes dan tidak ada kaitannya dengan kesang- gupan membayar. ”SPI yang kami tetapkan memang nilai terendah yang harus dibayar ca- lon mahasiswa. Tapi bukan ber- arti yang sanggup membayar tinggi akan menang dibanding- kan di bawahnya. Semua tetap dilihat pada kompetensi yakni nilai SBMPTN. Meski sanggup membayar tinggi tapi nilai ren- dah tentu tidak akan masuk,”te- gas dosen Statistika ITS. (uus) resmi masuk sekolah kawasan. Hal yang sama diakui Ninik Suprapti, orangtua Afni. Al- hamdulillah, Afni sudah daftar ulang ke SMAN 6, ungkapnya. Sebelumnya, Nabila dan Afni sempat protes ke kantor Dindik karena namanya tidak masuk dalam daftar siswa pemenuhan pagu sekolah kawasan. Padahal nilai keduanya lebih tinggi dari siswa yang sudah tercatat di pe- menuhan pagu. Kasus siswa memiliki nilai tinggi tetapi tidak masuk daftar pemenuhan pagu sekolah ka- wasan, tak hanya dialami dua siswa asal SMPN 4, Nabila Alifia Kusuma dan Mochamad Afni, tapi belasan siswa lainnya. Mereka juga memprotes hal itu ke Dindik. Hanya saja, mereka te- tap tidak lolos karena tidak sesuai prosedur pemenuhan pagu. Kepala Bidang Pendidikan Menengah Dindik Surabaya, Rudy Winarko, menerangkan prinsip untuk bisa masuk dalam pemenuhan pagu ini harus da- lam satu sub rayon. Meski memiliki nilai tinggi, jika tidak dalam satu sub rayon maka siswa tersebut tidak akan masuk saat pemenuhan pagu. Dia mencontohkan siswa asal Kecamatan Sawahan yang me- milih SMAN 9, SMAN 18 dan SMAN 4 Surabaya. Di seleksi tahap pertama dia tidak lolos. Tapi saat proses pemenuhan pagu ternyata nilainya bisa me- menuhi pagu di SMAN 18. Na- mun siswa ini tidak berhak me- menuhi pagu SMAN 18 karena sekolah tersebut di luar sub ra- yonnya. ”Berbeda jika nilai dia memenuhi pagu di SMAN 9 dan 4. Dia otomatis masuk karena dua sekolah tersebut dalam sub rayon. Kasus yang seperti ini ba- nyak sekali,” jelas Rudy, saat di- temui di kantornya. Dijelaskan Rudy, kebijakan ini supaya para siswa bersekolah di daerahnya sendiri. Agar dalam proses pemenuhan pagu jalur reguler tidak terulang protes serupa, Rudy meminta pada siswa maupun orangtua agar lebih cermat dalam memilih sekolah. Disarankan mereka me- milih sekolah dalam sub rayon agar jika sewaktu-waktu ada pe- menuhan pagu ada peluang un- tuk tersangkut. Terkait pagu yang sudah ter- lanjur diisi siswa lain, menurut penyuka olahraga off road ini, sis- wa di rangking bawah yang su- dah daftar ulang itu tidak akan dibatalkan karena namanya su- dah masuk dalam daftar. ”Ketika namanya sudah masuk daftar, apapun resikonya tetap kami pakai. Kalau siswa memang berhak, dia tetap akan mendapat hak itu. Itu konsekuensi dari Di- nas Pendidikan,” urainya. Mengenai siswa yang masuk di dua sekolah berbeda, menurut Rudy, hal itu dimungkinkan saja. Karena sistem pemenuhan pagu yang dibuat memang mengutama- kansiswadalamsatusubrayon. Dia mencontohkan siswa asal Kecamatan Genteng (SMPN 1) yang memilih SMAN 2 dan SMAN 16. Awalnya dia masuk di SMAN 16 Surabaya. Setelah pro- ses pemenuhan pagu ternyata na- manya masuk juga di SMAN 2. HalitubisaterjadikarenaSMAN 2 adalah sub rayonnya. Dan, untuk siswa seperti ini, pihak sekolah ha- rus membebaskan dia memilih se- kolahnya. ”Boleh saja dia memilih tetap di SMAN 16 atau malah ma- suk ke SMAN 2. Itu hak siswa. Se- kolah tidak boleh memaksa. Kalau ada yang memaksa itu pelanggar- an,”tegasnya. (uus) mudik dan arus balik yang dipastikan mengalami peningkatan jumlah pe- numpang yang sangat besar. Bambang memperkirakan kenaikan jumlah pemudik di Lebaran 2013 ini bisa mencapai 20 persen. Hal ini ber- dasarkan survei kami di delapan kota besar tujuan mudik, jelasnya. Untuk jumlah pemudik yang me- ningkat,tetap akan didominasi pemu- dik sepeda motor. Kemudian angkut- an umum darat bus, baru kereta api dan pesawat. Kalau kereta api, dipastikan jumlah- nya akan tetap, karena adanya atur- an one seat one man. Sedangkan untuk angkutan udara, Kementerian Perhu- bungan sudah pasti memberikan per- setujuan atas permintaan extra flight dari maskapai-maskapai yang meng- ajukan. Berapapun permintaan me- reka, akan kami beri untuk pengajuan extra flight-nya, tandas Bambang. Sementara itu, peluncuran buku yang dilakukan di TB Gramedia itu, merupakan karya buku kelima Bam- bang. Sedangkan untuk pembedahnya hadirAgus Pambagio dari Masyarakat Transportasi Indonesia, Bambang Ha- ryo Sukartono, Direktur PT Darma La- utan Utama (DLU), dan dosen ITS, Tri Ahmadi. Dengan moderator pelawak Djadi Galajapo. Tambah Enam Jam Syahroni Effendi, Manager Ope- rasional Bandara Interasional Juan- da,memastikan sudah ada permintaan penambahan extra flight dari maskapai internasional. Extra flight dari maskapai interna- sional ini mencapai enam jam. Mere- ka masih dalam tahap pengajuan un- tuk diteruskan ke Otoritas Bandara dan Kementerian Perhubungan. Extra Fligth itu akan berlangsung mulai awal Ramadan atau 8 Juli 2013. Extra Flight ini, dari informasi yang disampaikan kepada maskapai ke- pada bandara, adalah karena adanya kenaikan jumlah penumpang dari be- berapa negara tujuan Surabaya. “Di antaranya adalah penumpang dari ne- gara-negara Hongkong, Saudi Arabia, Singapura, dan Thailand,” jelas Syah- roni. Apakah penumpangnya merupa- kan para tenaga kerja Indonesia (TKI) dan tenaga kerja wanita (TKW), Syah- roni menyebutkan kemungkinan besar adalah hal itu. “Tapi seberapa banyak, mereka tidak memberikan informasi,” jelasnya. Penumpang dari empat negara ini, lanjut Syahroni, diperkirakan akan tiba lebih awal. Sementara dari Ma- laysia, seperti pengalaman-pengalam- an sebelumnya, biasanya baru mulai berdatangan di H-2 hingga H–1 Hari Raya Idul Fitri. (rie) siap memberikan sanksi tegas sekolah swasta yang tidak men- jalankan aturan mitra warga. ”Tiga tahun lalu, sebelum kelu- ar perda kami pernah menutup izin tiga sekolah swasta karena tidak mau menerima siswa miskin. Apalagi sekarang yang sudah ada perda tentang siswa miskin,” kata Rudy. Dia meminta sekolah tidak hanya menunggu pendaftar, tapi harus proaktif mencari siswa di lingkungannya yang memiliki keterbatasan ekonomi untuk dimaukkan jalur mitra warga. Jalur ini tidak akan membe- bani keuangan sekolah karena biaya operasional sekolah akan disokong pemerintah, baik pusat maupun pemkot melalui dana hibah daerah. Sekolah swasta yang sudah menerapkan sistem ini adalah SMK Trisila. Sekolah yang berlo- kasi di Jalan Undaan Kulon 57- 59 ini mematok pagu 10 dari 200 total pagu di sekolahnya untuk siswa kurang mampu. Hingga Jumat (28/6) sudah ada sembilan siswa yang dipastikan diterima. Satu siswa lain masih menunggu verifikasi. “Siswa ini belum kami pu- tuskan diterima karena tempat tinggalnya cukup jauh di daerah Kapas Madya,” terang Aris Su- bekti, Kepala SMK Trisila. (uus) Surabaya ke mobil jenazah menuju TPU Keputih. Dalam upacara penghormatan dan pelepasan jenazah, Plt Sekretaris DPRD Surabaya, Siti Kholifah, mem- bacakan riwayat hidup dari Imanuel Lumoindong. Diantaranya Imanuel meninggal dalam usia 62 tahun dan kini masih tercatat sebagai anggota Komisi A DPRD Surabaya dari Frak- si Partai Damai Sejahtera (PDS). Sejumlah prestasi tugas pernah diraih almarhum diantaranya ketua panitia Festival Kulintang tingkat Kota Surabaya, kata Siti Kholifah dalam sambutan pelepasan jenazah. Ketua Fraksi Partai Damai Sejahte- ra (PDS), Simon Lekatompesy, meng- ucapkan terima kasih atas diberi- nya kesempatan jenazah Imanuel Lumoindong bersemayam sejenak di DPRD. Kami memintakan maaf Pak Imanuel kepada lembaga DPRD jika selama menjalankan tugas dan kerja di DPRD ada kesalahan yang tidak disengaja, kata Simon. Almarhum Imanuel Lumoindong, ungkap Simon, dikenal sebagai mitra dan teman kerja yang baik dan berdedikasi. Sebagai orang yang di- tuakan di DPRD Surabaya, Imanuel semasa hidup menjadi tempat curah- an hati dan teman berdiskusi yang bisa memecahkan segala persoalan. Kami sangat kehilangan atas ke- pergian beliau, Pak Imanuel, semoga arwah beliau diterima disisi-Nya, ucap Simon. Sementara Machmud mengatakan, persemayaman sejenak bagi anggota DPRD yang meninggal dunia seba- gai tradisi baru. Karena selama ini belum pernah ada jenazah anggota DPRD Surabaya yang masih aktif dan meninggal dunia diberi peng- hormatan terakhir dan pelepasan jenazah di gedung DPRD Surabaya. Mungkin agenda semacam ini akan bisa terus dilanjutkan sebagai wujud rasa duka dan ikut kehilang- an serta dalam pemberian penghor- matan terakhir pada jenazah anggota DPRD Surabaya, kata Machmud dalam sambutan penghormatan dan pelepasan jenazah. Lembaga DPRD Surabaya sendiri, menurut Machmud, sangat kehi- langan sosok yang bisa menjadi tempat mengadu dan berdiskusi bagi anggota DPRD Surabaya. Ini dikarenakan Imanuel sebagai politisi senior yang memiliki pandangan jauh ke depan, sehingga memuncul- kan inspirasi dalam kerja dan pendi- rian yang teguh. Kami sangat kehilangan beliau, Pak Imanuel Frederik Lumoindong, DPRD sangat menghargai apa yang telah diberikan oleh almarhum dan menghaturkan beribu terima kasih atas pengabdiannya, ucap Machmud. Sedangkan perwakilan keluarga sekaligus putra pertama, Mario Yosua Lumoindong, mengucapkan banyak terima kasih atas diberinya kesempat- an jenazah ayahnya disemayamkan di gedung DPRD Surabaya. Kami atas nama papa meminta permohonan maaf apabila selama menjalankan tugas kedewanan ter- dapat kesalahan dan kekurangan, tutur Mario mengakhiri sambutan. (ahmad amru muis) Sekolah Swasta... DARI HALAMAN 9■ Usai acara penyambutan, dilanjutkan dengan peninjauan ke barak prajurit Tidur Dalam Batalyon Arhanud-1 Mari- nir yang sebelumnya didahului dengan penyerahan bunga oleh Kapten Marinir Johan yang merupakan prajurit tertua Tidur Dalam Korps Marinir di wilayah Surabaya. Dalam peninjauan ke barak prajurit tersebut, Penny Marsetio juga menyem- patkan melihat isi almari prajurit tidur dalam dan ruang makan. Selesai menin- jau barak prajurit, dilanjutkan dengan foto bersama dengan prajurit tidur dalam di lapangan apel Bhumi Marinir Karangpilang. Selanjutnya mengikuti kegiatan di Lapangan Tembak FX Soepramono un- tuk mendengarkan arahan dari Penny Marsetio dan ceramah dari Dr Boyke Dian Nugraha tentang bahaya penyakit HIV/AIDS beserta cara pencegahannya. Di samping itu, mereka juga mendapat siraman rohani dari Ustadz Abdul Aziz. Kemudian acara dirangkai dengan ramah tamah dan unjuk kebolehan dari prajurit tidur dalam berupa “Opera Van Marinir.” Seluruh rangkaian acara ditutup dengan tampilan Parodi Owah Band dengan bintang tamu Wawin Lawra. Turut hadir dalam kesempatan tersebut Kepala Staf Pasmar-1 Kolonel Marinir Bambang Suryo Aji, Danlanmar Surabaya Kolonel Marinir M Hari, Aspers Dankor- mar Kolonel Marinir Purnomo, Danko- latmar Kolonel Marinir Budi Purnama, Dankolak Pasmar-1, para Asisten Pasmar- 1, para Pengurus Pusat Jalasenastri, dan Pengurus Gabungan Jalasenastri Kormar serta Pengurus Korcab Pasmar-1. (rie) Ibu Asuh... DARI HALAMAN 9■ Tak Ada Tuslah... DARI HALAMAN 9■ Tradisi Baru... DARI HALAMAN 9■ Dindik Salah... DARI HALAMAN 9■ SURYA/HABIBUR ROHMAN BARENG BARBIE - Sejumlah anak-anak berebut foto bersama tokoh karakter Barbie pada Meet and Greet di Ovale Hall Ciputra World Surabaya (CWS), Jumat (28/6). Surabaya, surya - Di musim liburan sekolah ini, pengunjung mal Ciputra World Surabaya (CWS) dimanjakan dengan kehadiran tokoh karak- ter Barbie. Pertunjukan Barbie in The Pink Shoes ini menyapa pengunjung CWS hingga 7 Juli mendatang. Barbie in The Pink Shoes mengi- sahkan tentang tentang seorang balerina di sekolah balet. Kathe- rin namanya. Suatu hari, Katherin menari di atas panggung. Dia harus berla- tih untuk pertunjukkan penting malam harinya dimana Institusi Balet Internasional akan hadir. Suatu ketika sepatu balet ke- sayangannya rusak begitu saja. Sang manajer, Heila membawa- nya ke ruang kostum. Meminta bagian kostum mencari sepatu sesuai dengan ukuran kaki Ka- therin. Namun Heila tidak dapat menemukan sepatu yang tepat. Akhirnya, desainer di tempat kostum, memberikan sepatu balet yang indah. Sepatu balet berwarna pink. Katherin senang bukan main. Dia langsung mele- pas sepatu lamanya yang rusak, lalu menggantinya dengan se- patu baru berwarna pink yang berkerlap-kerlip gemilau. Keajaiban terjadi seketika setelah Katherin mengenakan sepatu pinknya. Ruang kostum berubah menjadi pedesaan yang hijau dan damai. Stephana Favriera, Kordinator Promosi CWS menjelaskan, to- koh karakter Katherin si balerina dalam kisah Barbie ini akan hadir untuk Meet and Greet pada Jumat (28/6) hingga Minggu (30/6). Selain itu, pengunjung juga dapat berbelanja merchandise Barbie mulai dari baju, sepatu, parfum, sabun, shampoo, kebu- tuhan sekolah dan boneka sampi sepeda dan tabungan Barbie.(iit) Pengunjung Ciputra World Bisa Foto Bareng Barbie Wajib Bayar Uang GedungMahasiswa Jalur Kemitraan dan Mandiri■ Di Universitas Airlangga sumbangan pengembangan pelayanan pendidikan (SP3) berganti nama menjadi uang kuliah awal (UKT). Besaran UKT tergantung jurusannya Di ITS bernama sumbangan pengembangan institusi (SPI) Namun, tarikan UKA di Unair jauh lebih tinggi besarannya dibandingkan rata-rata di ITS. ■ ■ ■ storyhighlights kami minta tanah KBS untuk di- kelola BUMD KBS, ucapnya. Dijelaskan Risma, nantinya para karyawan KBS yang telah memiliki pengalaman merawat dan memelihara binatang akan dipertahankan. Karena peng- alaman dan ketrampilan mereka cukup mahal nilainya sehingga BUMD KBS akan menjadikan sebagai karyawan. Jadi, semuanya yang ada di KBS akan dipertahankan. Baik itu SDM, binatang, dan bangun- an. Karena nanti hanya manaje- men KBS saja yang berubah, tapi aneh juga ya kok binatang pada dipindah padahal kami berniat baik lho, tutur Risma yang ti- dak akan pernah menutup KBS. Di sisi lain, upaya anggota DPRD Surabaya untuk mende- sak Kemenhut memberikan izin lembaga konservasi (LK) KBS ke Pemkot Surabaya gagal. Ini setelah anggota komisi B yang berusaha menemui Direktor Jendral Perlindungan Hutan dan Konservasi Alam (PHKA) Kemenhut untuk mendesak di- keluarkanya izin LK ke pemkot tidak berhasil dan justru diarah- kan ke Balai Konservasi Sumber Daya Alam (BKSDA) Jatim. Yang memiliki kewenangan memberi izin LK KBS itu Dirjen PHKA. Jika menemui BKSDA artinya salah alamat dan sama saja tidak ada hasilnya, ini men- jengkelkan namanya, kata Tri Setijo Puruwito, wakil Ketua Komisi B DPRD Surabaya. Padahal, ungkap Tri Setijo, kedatangan anggota komisi B ke Kemenhut merupakan upa- ya lanjutan dan terakhir untuk menghindari eksekusi tanah KBS oleh Pemkot Surabaya. Di- mana hanya izin LK bagi pem- kot tersebut yang bisa menghen- tikan eksekusi tanah KBS. Jadikamiangkattangandengan Kemenhut yang memang kami ni- lai seolah telah mempermainkan persoalan KBS. Makanya jangan salahkan pemkot jika mengambil alihpaksaKBS,ucapTriSetijo. Sedangkan untuk langkah eksekusi, ungkap Tri Setijo, pi- haknya berharap pemkot tidak menghancur leburkan semua ba- ngunan yang ada di atas tanah KBS. Melainkan hanya melaku- kan pengambil alihan KBS saja secara simbolis. Dan, seluruh pihak yang mengaku memiliki kepentingan dengan KBS di luar karyawan KBS dan pengunjung, tidak lagi diperbolehkan masuk dan menjalankan aktivitas di KBS tanpa seizin dari BUMD KBS. Kami kira Ibu Wali Kota telah mempunyai rencana eksekusi tanah dengan aman tanpa me- nimbulkan kerusakan. Dan kami harap semua pihak yang ada di KBS ikut membantu jalanya ek- sekusi oleh pemkot tanpa meng- ganggu kenyamanan pengun- jung, tutur Tri Setijo. (aru) Saya Ditanya... DARI HALAMAN 9■ join follow @portalsurya
  • 17. | MALANGLINES| SABTU, 29 JUNI 2013 KEPANJEN, SURYA- Petualangan Munari (47), tersangka perampokan asal Desa Ban- jarejo, Kecamatan Pakis,Kabupaten Malang berakhir pada Kamis (28/6) malam. Ia hanya menahan sakit ketika dua peluru petugas menembus betisnya. Munari merupakan salah satu anggota ka- wanan perampok. Ia mengaku ikut beraksi di dua tempat yaitu di Pakis dan Pakisaji. “Kasus perampokannya sudah lama,” ujar Munari kepada Surya di Polres Malang, Jumat (28/6). Ketika beraksi di Gentong, Kecamatan Pakis, bersama sejumlah temannya, Munari mendapat bagian Rp 1,8 juta. Sedang saat beraksi di Desa Wonokerso, Kecamatan Pa- kisaji, ia gigit jari karena tidak diberi apapun oleh teman-temannya. “Tetapi sejak kejadian itu saya sudah tobat,” ujar Munari. Sebelum terlibat perampokan, Munari ternyata juga pernah terlibat kasus perjudi- an. Menurut Munari, saat beraksi di Pakis, kawanannya berhasil menggasak tiga motor plus perhiasan emas. Tugasnya saat beraksi di Pakis bukan sebagai eksekutor, namun menjadi penjaga situasi. Sedang ketika ikut beraksi di rumah Hasyim di Desa Wonokerso, Kecamatan Pakisaji pada 2009, motor yang diembat ternyata dibawa kabur temannya, S. Te- tapi Munari menegaskan bahwa dia tidak ikut lagi ketika kawanannya beraksi di rumah Hasyim pada 2013. Meski begitu, Munari sempat menyebutkan sejumlah nama temannya ketika beraksi di Pakis maupun Pakisaji. Kasubag Humas Polres Malang, Ipda So- leh Masudi, menunjukkan beberapa barang bukti seperti linggis, obeng, dan sebilah clu- rit. Menurut pengakuan Munari, saat berak- si, teman-temannya biasanya berboncengan dengan sepeda motor. Munari mengaku uang hasil dari peram- pokan itu telah bahis untuk judi. Menurut Soleh, pekan lalu, tim Buru Sergap (Buser) Polres Malang juga telah menangkap ang- gota kawanan perampok lainnya, yaitu Salik di sekitar Kecamatan Wajak. Salik juga diha- diahi timah panas. Dari pengakuan tersangka Salik, tiap pelaku perampokan tidak selalu beraksi dalam kawanan yang sama. Jadi bisa ber- gabung juga dengan kawanan lainnya. Pe- rampokan di Kabupaten Malang beberapa kali terjadi, seperti di Kepanjen, Pakisaji, Pakis, Tumpang, Poncokusumo, dan La- wang. (vie) Kami mensinyalir ada peluang itu,” sambungnya. MCW menganalisa para pe- laku kecurangan ini terdiri dari dua pihak, yaitu pihak sekolah dan pihak di luar sekolah. Untuk pihak sekolah, lanjutnya, oknum yang terlibat bisa kepala sekolah (kasek), maupun guru. Sedang pihak luar merupakan oknum yang memiliki kekuasaan dalam hal politik maupun kebijakan. “Kalau untuk oknum pihak se- kolah, motifnya mencari untung, sedang oknum luar sekolah mo- tifnya intimidasi,” jelasnya. Modus kecurangan PPDB lain, lanjut Zainuddin, adalah saat siswa telah dinyatakan lolos PPDB. Setelah pengumuman, pi- hak sekolah berpotensi menekan wali murid untuk membayar uang dalam jumlah tertentu. “Alasan pembayaran uang itu berbagai macam, yang intinya menekan wali murid untuk membayar. Kalau tidak memba- yar, maka langsung dicoret, dan pagunya menjadi pagu siluman lagi,” urainya. Untuk itu, Zainuddin meng- imbau warga Malang yang akan mengikuti PPDB agar berani me- nyuarakan diri ketika menemui modus-modus seperti ini. MCW, ungkapnya, siap menerima pengaduan warga Malang jika melihat atau mengalami kecu- rangan PPDB Kota Malang 2013. “Kami buka Posko Pengaduan terkait PPDB ini,” tutupnya. Khawatir Katrol Nilai Dindik menjamin penyeleng- garaan PPDB sistem online ini bersih dari kecurangan. Penye- lenggaraan PPDB yang terbuka dan real time untuk publik, membuat akuntabilitas PPDB bisa diamati bersama. “Prosesnya terbuka di inter- net, angkanya pasti, warga pun bisa langsung melihat sekaligus mengawasi,” kata Suwarjana, Kepala Bidang Pendidikan Me- nengah Dindik Kota Malang, Jumat (28/6). Mengenai jumlah pagu se- kolah yang mungkin menjadi sumber kecurangan, Suwarjana memastikan pagunya sama se- perti yang dirilis Dindik, Kamis (27/6) lalu. “Untuk SMAN 2.827 siswa dan SMPN 6.521 siswa. Tidak akan berubah apalagi ada pagu siluman,” sambungnya. Suwarjana membeberkan po- tensi kecurangan PPDB online ini bukan pada adanya pagu siluman, melainkan modifikasi nilai calon peserta didik baru. “Bisa saja wali murid atau lembaga sekolah mengatrol nilai rapor anak didiknya. Tapi untuk hal ini, Dindik sudah memiliki data base nilai rapor seluruh siswa Kota Malang. Untuk siswa luar kota, kami akan kordinasi dengan Dindik kota siswa ber- sangkutan,” jelasnya. Ketua Komisi D DPRD Kota Malang, Fransiska Rahayu Budi- wiarti, menegaskan pihak sekolah jangan sampai menggugurkan siswa yang lolos PPDB karena tidak mampu membayar. Jika telah dinyatakan lolos PPDB, siswa tersebut harus diteri- ma sekolah bersangkutan. Perem- puan yang biasa disapa Siska ini mengatakan Komisi D tidak akan mentolelir jika ada sekolah yang mencoret siswa hanya karena tidak mampu bayar. “Warga bisa melapor ke kami jika memang ada yang dicoret tanpa ada alasan jelas. Sekolah akan kami minta pertanggungja- wabannya nanti,” tandas Siska. Sekolah juga wajib menerima siswa inklusi (berkebutuhan khusus), asalkan siswa tersebut memenuhi syarat nilai dan men- dapat rekomendasi dari psikia- ter.(isy) mendapatkan bibit untuk ditanam di rumah masing-masing.Diharapkan, pembudida- yaan stroberi bisa dilakukan di setiap pe- karangan rumah agar para wisatawan bisa langsung mengunjungi rumah warga. Selain itu, dana tersebut akan digunakan untukmeningkatkan produksi dan memper- cantik lahan stroberi seluas 4 hektare yang sebelumnya sudah ada. “Kami juga akan bengkitkan home indus- try untuk mengolah buah stroberi menjadi minuman sari stroberi, selai, dan dodol,” harapnya. (iks) “Waktu pendaftarannya sudah lewat sehari dari ketentuan,” ungkapnya. Pilwali Kota Malang yang di- gelar 23 Mei 2013 dimenangkan pasangan M Anton-Sutiaji (AJI). PasanganSR-MKmenilaiadake- curanganpolitikuang,sementara RAJA mempunyai perhitungan sendiri atas hasil Pilwali itu. Patuhi Putusan Sekretaris tim pemenang- an SR-MK, Hadi Santoso menghormati keputusan MK. Menurutnya, pihaknya hanya ingin memaparkan pelang- garan Pilwali, tentang adanya politik uang. Namun ternyata MK mempunyai pendapat lain. “Apa pun keputusan MK, kami menghormati. Kami bisa menerima keputusan tersebut,” ujarnya. Ketua Program Studi Ilmu Hukum Universitas Widya Gama Malang, Zulkarnaen sudah memprediksi jauh-jauh hari bahwa gugatan tersebut pasti ditolak. Dikatakan Zulkarnaen, ini karena para pemohon, baik SR- MK dan RAJA memang tidak memahami syarat gugatan. Tim SR-MK dianggap tidak memahami tenggat waktu pendaftaran gugatan perseli- sihan hasil pemilihan umum (PHPU) sehingga gugatan kedaluwarsa.(day) itulah satu di antara beberapa faktor utama penyebab obesitas,” kata Iyus saat ditemui Surya di Kampus UMC, Jumat (28/6). Lebih lanjut, mahasiswa jurusan Teknik Industri UMC ini, memaparkan obesitas merupakan momok penyebab kematian nomor 5 di dunia. “Kalau dibiarkan, obesitas bisa menimbulkan kematian. Sebab dari obesitas akan menimbulkan berbagai penyakit lain seperti jantung, stroke, dan lainnya,” papar Iyus. Dari sinilah Iyus memiliki ide membuat ramuan antiobesitas. Pilihannya jatuh untuk membuat jamu. Menurut Iyus, ramuan jamu sangat minim efek samping ketimbang ramuan kimia. “Selain itu, jamu juga sudah akrab dan dipercaya khasiatnya oleh masyarakat Indonesia,” tutur Iyus. Namun, Iyus ingin ada sesuatu yang baru pada produk jamunya. Karena UMC satu- satunya kampus di Indonesia yang memiliki laboratorium pigmen, Ma Chung Research Center for Photosynthetic Pigmenst (MRCPP), Iyus ingin produk JAO ini mencerminkan kekhasan almamaternya. Mahasiswa kelahiran Malang 19 November 1991 ini meng- ungkapkan ada tiga pigmen tumbuhan khas Indonesia yang menjadi formula utama JAO, selain tumbuhan lain yang biasa dipakai untuk jamu galian singset pada umumnya. Dari tiga pigmen itu, Iyus membeberkan satu, yaitu pig- men fukosantin yang didapat dari tumbuhan rumput laut co- kelat (Sargassum cristaefolium). “Rumput laut cokelat biasanya hanya menjadi sampah di laut. Padahal, pigmennya sangat berharga, karena fukosantin ini sifatnya selalu ingin membakar lemak,” urainya. Ketika ditanya cara penyajian, Iyus menerangkan sama seperti menyedu jamu pada umumnya. Satu saset JAO 5,6 gram disedu dengan 250 ml air panas bersuhu 70 derajat celsius, dan diminum satu kali sehari. “Untuk jangka waktu pengurangan berat badan tiap orang berbeda, bisa beberapa hari atau bulanan. Ini karena kondisi tubuh masing-masing orang berbeda,” jelas Iyus yang sejak Juli 2012 mengembangkan JAO. Mengenai rasa, Iyus menga- takan JAO tidak sepahit jamu yang lain. Ini merupakan efek tiga pigmen tumbuhan yang di- gunakan. “Bisa dibilang rasanya seperti minuman rumput laut. Saya masih mengembangkan untuk varian rasa, seperti rasa madu, agar bisa dinikmati ba- nyak orang lagi,” ungkap Iyus yang mengatakan JAO merupa- kan penelitian skripsinya. Rektor UMC yang sekaligus pembimbing skripsi Iyus, Leenawaty Limantara PhD, me- ngatakan penggunaan pigmen pada JAO ini tidak lepas dari penelitian pigmen di MRCPP yang sudah berdiri sejak 2007. Perempuan yang biasa disapa Shinta ini memastikan produk JAO milik Iyus sudah lulus semua uji klinis. “Baik dari Balai Penelitian Obat dan Makanan (BPOM), standar SNI, hingga Departeman Kesehatan (Depkes). Resep JAO ini masih kami rahasiakan karena sedang diuruskan hak patennya,” imbuh Shinta. Bahkan Shinta mengungkap- kan, produk JAO Iyus sudah digandeng produsen jamu ternama untuk dipasarkan secara massal. “Jamu yang dibuat Iyus selain melestarikan warisan budaya nasional dan menggunakan bahan alami, juga didasari atas hasil riset ilmiah yang sophisticated. Jika tidak ada halangan, bulan depan akan kami launching ke publik,” ucap Shinta. (irwan syairwan) Putusan... DARI HALAMAN 9■ Rp 100 Juta... DARI HALAMAN 9■ Berbahan... DARI HALAMAN 9■ Waspada... DARI HALAMAN 9■ SURYA/HAYU YUDHA PRABOWO LIBURAN SEKOLAH - Ratusan anak bermain air di salah satu wahana di Taman Wisata Air Wendit, Kecamatan Pakis, Kabupaten Malang. Tiket masuk yang murah menjadikan taman wisata ini menjadi jujugan warga Malang Raya mengisi liburan sekolah. Foto diambil Kamis, (27/6). Polisi Tembak Tersangka Perampokan Pakis Pembunuhan di Mulut Gang MALANG, SURYA - Polisi akhirnya berhasil membekuk seorang tersangka pembu- nuhan Anang Fadila (32), war- ga Jalan Bingkil, Kota Malang. Tersangka pembunuhan yang bernama Toni itu dibekuk di Ciptomulyo, Kecamatan Sukun, Jumat (28/6). Sedang tersangka lain dalam pem- bunuhan pada Kamis (27/6) malam itu masih buron. Pembunuhan Nanang terjadi di Jalan Peltu Sujono, Gang Mahatari, Kelurahan Janti, Ke- camatan Sukun, Kota Malang. Menurut Ketua RT5 RW2, Sunarko kejadian tersebut berlangsung cepat. Selepas maghrib, sekitar pukul 18.30 WIB, tiba-tiba terjadi keri- butan di mulut gang. Saat dirinya keluar rumah, dilihat- nya sesosok tubuh tergeletak berlumuran darah. “(Saat itu) Warga kebanyakan masih nga- ji dan shalat di rumah. Begitu kami keluar sudah ada yang meninggal,” katanya, ditemui Kamis malam (27/6). Meski demikian, bukti kekerasan tersebut masih membekas di mulut gang. Darah korban tercecer hingga ke tengah Jalan Peltu Sujono sepanjang lima meter. Warga sekitar menutupi bekas darah tersebut dengan pasir. Malam itu juga polisi me- ngejar pelaku pembunuhan pria yang biasa disapa Nanang itu. Beberapa mobil polisi terlihat mondar-mandir di se- kitar lokasi. Sementara polisi berpakaian sipil juga terlihat menyusuri sejumlah gang di sekitar lokasi kejadian. Hingga kini, belum ada pen- jelasan pasti atas latar belakang pembunuhan tersebut. Menu- rut adik Nanang yang enggan disebut namanya, awalnya di- rinya dan Nanang nongkrong di Gang Matahari. Sekitar pu- kul 17.00 WIB, dirinya pulang. “Ada beberapa orang yang ikut nongkrong. Saya pulang duluan, sementara kakak saya masih di lokasi,” tuturnya. Namun sekitar pukul 19.00 WIB, dirinya diberi tahu jika kakaknya tewas terbunuh. Pria Berkuncir Sumber lain di sekitar kejadian, menyebut Nanang terlibat perang mulut dengan seorang ABG (anak baru gede). Karena tersinggung, ABG tersebut kemudian pergi memanggil teman-temannya. ABG yang dendam tersebut mengeroyok bersama teman- temannya. “Ada sekitar tujuh orang, atau bahkan lebih,” ujar sumber tadi. Seorang pelaku berpakai- an putih dengan rambut di- kuncir belakang memegang sebilah pisau sepanjang 40 cm. Pelaku tersebut menya- betkan pisau tersebut ke dada kiri Nanang. Nanang yang sempoyongan berusaha berlari. Namun pelaku kem- bali menyabetkan senjatanya berulang kali. “Setelah itu para pelaku menghilang,” tambahnya. Warga sekitar sempat mela- rikan Nanang ke Rumah Sakit Islam Aisiyah, menggunakan becak. Namun nyawa tukang daging di Pasar Induk Gadang ini tidak tertolong. Pihak kepolisian belum bisa memberikan keterangan ter- kait kasus ini. Menurut Kasat Reskrim Polres Malang Kota, Ajun Komisaris Polisi (AKP) Arif Kristanto, pihaknya ma- sih melakukan penyelidikan.. Sepeda motor yang ditinggal pelaku berhasil diamankan polisi.(day) Seorang Tersangka Berhasil Dibekuk■ 15 angkutan harus berhenti di Gubuk Klakah. Selanjutnya, jika ada penumpang yang ingin meneruskan hingga ke Bromo, harus naik jip yang sudah disiapkan paguyuban. Menurut Untung, keluhan pelanggaran jalur ini semula dilaporkan ke UTPD Dishub- kominfo di Tumpang. Namun kemudian ditindaklanjuti dengan mengumpulkan para ketua paguyuban. “Jika mengacu pada Ke- putusan Menteri (KM) No 35/2003, melakukan penyim- pang trayek boleh asal ada izin insidentil dari Dishubko- minfo,” katanya. Izin insidentil harus dilaku- kan untuk satu kali pelaksana- an. Dari data di Dishubkomin- fo Kabupaten Malang, jumlah armada angkutan pedesaan TA sebanyak 150 unit. Sedang armada GTM sebanyak 32 unit. Armada jip sebanyak 70 unit. Direncanakan, rest area Gubuk Klakah akan diopti- malkan dengan ditingkatkan menjadi APK (area parkir kendaraan). (vie) Berbagi... DARI HALAMAN 9■ join follow @portalsurya
  • 18. Sidoarjo Region SIDOARJO, SURYA - Pendaftaran Penerimaan Peserta Didik Baru (PPDB) di hari ketiga, lulusan SDN Sumorame, Kecamatan Candi menguasai tujuh SMPN di tengah kota. Sesuai data yang terekam di situs www.ppdbsido-, siswa SDN Sumorame yang masuk dalam seleksi tahap I di SMPN 2 Sidoarjo sebanyak delapan siswa. Siswa yang mendaftar di SMPN 2 nilai terting- ginya 29.30 dan nilai terendah 28,50 di urutan 62. Di SMPN 3 Sidoarjo yang masuk nomor urut satu sampai 42 sebanyak 23 anak dan nilainya 29.00-29.50. Sedangkan di SMPN 4 Sidoarjo hanya satu anak dan masuk dalam urutan nomor 60, nilainya, 28,30. Sementara di SMPN 5 Sidoarjo, jumlah siswa SDN Sumorame masuk nomor urut sampai delapan de- ngan nilainya 28.10 sampai 29,20. Total siswa SDN Sumorame yang menguasai SMPN di pusat kota sebanyak 136 siswa. Sementara itu, Hendra Setiawan siswa SDN Candi, peraih nilai ujian nasional (NUN) 29,80 ter- tinggi se-Jatim, mendaftar di SMPN 3 Candi masuk dalam urutan 133. Karena NA yang dipakai masuk mendaftar 27,90. Sekretaris Dindik Sidoarjo, H Mustain Baladan, men- jelaskan pagu SMPN di Sidoarjo jumlahnya tidak seba- nyak dengan lulusan siswa SD. Jumlah pagu SMPN yang tersebar di 42 sekolah hanya 12.564, mulai jalur regulerdanjalurprestasi.SedangkansiswalulusanSD/ MI di Sidoarjo mencapai 33.345 siswa. (mif) Pernah Sukses Tukarkan Uang Palsu SIDOARJO, SURYA - Sin- dikat peredaran uang palsu (upal) di wilayah Sidoarjo, Pasuruan dan Malang dibong- kar anggota Satreskrim Polres Sidoarjo. Upal sebesar Rp 25 juta terdiri dari pecahan Rp 50.000 dan Rp 100.000 disita dari tangan Dimas Galih Pra- tikno, 28, warga Desa Jatirejo, Kecamatan Porong. Tersangka yang biasa di- panggil Yoga tersebut ditang- kap anak buah Kasat Reskrim AKP Rony Setyadi SIK di rumah kosnya di kawasan Candi, Kamis (28/6). Upal itu masih dalam kondisi utuh yang dikemas dalam kardus ukuran 15 cm x 30 cm. Di kardus yang ditutup kertas cokelat dan penuh lakban itu terdapat tulisan, kepada Bapak Kusnadi d/ a agen bus Pahala Kencana Bangil telp 0812950xxxx diambil di agen bus Pahala Kencana Bangil. Di belakang kardus tertulis atas nama pengirim atas nama Ningsih alamat Rawasari Barat III Jakarta Pusat. “Rupanya tersangka saat kami tangkap usai mengambil paketan yang dikirim dari Jakarta dan ditaruh di kamar- nya,” tutur Kasat Reskrim Pol- res SidoarjoAKP Rony Setyadi, Jumat (28/6). MenurutAKP Rony, sindikat ini dikendalikan langsung dari Jakarta dan baru membangun jaringan di Sidoarjo, Pasuruan dan Malang. Upal yang disita penyidik, diakui tersangka baru diambil dua hari lalu dan belum diedarkan ke masyara- kat umum. “Ini sangat berbahaya ka- rena merugikan masyarakat umum. Sasarannya adalah pe- dagang kecil di malam hari,” terangnya. Dalam pemeriksaan ter- ungkap, tersangka awalnya tertarik ‘bisnis’ upal karena setelah mencoba berhasil me- nukarkan uang mainan itu ke salah satu toko. Ia mendapat upal setelah bekerja di Jakarta dan ketemu dengan Ningsih (buron). Karena merasa ber- hasil, tersangka akhirnya ku- lakan lagi ke Jakarta dan setor uang Rp 2 juta dan dipasok upal senilai Rp 25 juta. Sisa- nya Rp 3 juta akan ditransfer setelah menjual uang mainan itu. Untuk mendapat upal yang kualitasnya jelek itu dihargai 1:5, artinya Rp 1 juta mendapat upal Rp 5 juta. Berdasarkan pengamatan, upal produksi Jakarta terlihat mutunya sangat jelek dan bila diraba masih terasa halus. Upal pecahan Rp 50.000 warnanya juga tidak bisa menyatu. Ada yang pudar dan biru tua. Dari garisnya sangat kelihatan jika itu hanya hasil scan komputer. Begitu pula untuk upal pecah- an Rp 100.000 warnanya juga kelihatan pudar. “Kemungkinan besar, ter- sangka Yoga akan menjual lagi upal yang kami sita. Makanya akan terus kami periksa untuk mengetahui sindikat ini,” jelas AKP Rony. Dalam sindikat peredaran upal, biasanya tersangka mere- krut kaum perempuan untuk menukarkan uang di pasar. Se- lain itu, tersangka juga dinilai memiliki jaringan peredaran upal di daerah lain. “Upal Rp 25 juta itu besar lho nggak mungkin ditukarkan dalam waktu yang cepat,” tan- dasnya. Tersangka Yoga saat rilis berlangsung, tidak mau men- jawab sepatah kata pun ke- pada wartawan. Ia memilih diam dengan kondisi tangan- nya diborgol. Dari mana upal diperoleh juga tidak dijawab. Tersangka hanya menatap ke upal yang dijajar untuk ba- han rilis di Satreskim Polres Sidoarjo. (mif) SURYA/ANAS MIFTAKUDIN UANG PALSU - Petugas dari Polres Sidoarjo saat menunjukkan tersangka Dimas Galih Pratikno bersama barang bukti uang palsu (upal) di Polres Sidoarjo, Jumat (28/6). SDN Sumorame Serbu SMP Tengah Kota Yoga Kulakan Upal Rp 25 Juta■ HALAMAN 16 | | SABTU, 29 JUNI 2013 join follow @portalsurya
  • 19. Super Ball | HALAMAN 17 | | SABTU, 29 JUNI 2013 futsal sidoarjo lebih kuat dari surabaya Pertandingan semifinal futsal Porprov 2013, Jumat (28/6), seperti reuni para pemain dari Liga Futsal Amatir (LFA) Jatim. Para pemain kedua kota sudah saling tahu, namun Sidoarjo ternyata lebih kuat dan menang 6-4 dari Surabaya. Di final, Sidoarjo akan bertemu Kota Madiun. baca halaman...24Super BallSABTU, 29 JUNI 2013 HALAMAN 17 LIVE ON TV Sabtu (29/6) pukul 15.30 WIB PELITA BR VS SRIWIJAYA FC Sabtu (29/6) pukul 19.00 WIB Minggu (30/6) pukul 23.00 WIB BRASIL VS SPANYOL Senin (1/7) pukul 05.00 WIB AFP PHOTO / CHRISTOPHE SIMON Data Pertandingan Spanyol 0-0 Italia Adu penalti: 7-6 Stadion: Governador Placido Aderaldo Castelo, Fortaleza, Ceara Wasit: Howard Webb Penonton: 56.083 Penalti: Candreva (gol), Xavi (gol), Aquilani (gol), Iniesta (gol), De Rossi (gol), Pique (gol), Giovinco (gol), Ramos (gol), Pirlo (gol), Juan Mata (gol), Montolivo (gol), Busquets (gol), Bonucci (gagal), Navas (gol) Kartu kuning: De Rossi (65’); Pique (105’) Kartu merah: - Susunan Pemain: Spanyol: Casillas; Arbeloa, Piqué, Sergio Ramos, Jordi Alba; Busquets; Pedro (Juan Mata 79), Xavi, Iniesta, David Silva (Navas 53); Torres (Javi Martinez 94) Italia: Buffon; Barzagli (Montolivo 46), Bonucci, Chiellini; Maggio, De Rossi, Pirlo, Giaccherini; Candreva, Marchisio (Aquilani 79); Gilardino (Giovinco 91) LIVELIVE ONON Sabtu (29/6) pukulSabtu (29/6) pukul PELITA BR VS SRIWPELITA BR VS SRIW Sabtu (29/6) pukulSabtu (29/6) pukul Minggu (30/6) pukuMinggu (30/6) pukul RASIL VS SPABRASIL VS SPA Senin (1/7) pukul 0Senin (1/7) pukul 0 NAVAS MATADOR SPANYOL 0 (7) VS 0 (6) ITALIA JESUS Navas melangkah pasti mendekati bola. Tatapan matanya sangat tajam. Dia tampak sangat berskonsentrasi untuk menunai- kan tugas berat sebagai eksekutor ketujuh Spanyol dalam drama adu penalti melawan Italia pada seminal Piala Konfederasi 2013 di Estadio Castelao, Jumat (28/6). Tanpa ada keraguan sedikit- pun, dengan tendangan keras, eksekusi Navas ke pojok kanan gawang tidak mampu dija- ng- kau Gian- luigi Buf- fon. Spanyol pun menang dengan skor 7-6 dan memperpan- jang nafas Tim Matador untuk tampil di nal. Akhir dari perseteruan Spa- nyol dan Italia di Piala Konfederasi berlangsung sangat dramatis. Kedua tim bermain sama kuat. Tak ada gol selama dua babak waktu normal dan dilanjutkan dengan perpanjangan waktu. Pada akhirnya Gli Azzurri harus menyerah lagi kepada Spanyol, seperti pada nal Euro 2012 lalu. Kali ini kekalahan Italia ditentukan oleh Navas, sosok yang sebenarnya bukan pemain penting di skuad Matador. Navas bukan pilihan utama Pelatih Vicente del Bosque. Di penyisihan grup ia hanya bermain 45 menit saat melawan tim lemah Tahiti. Di pertandingan seminal ini, Navas pun memulai laga dari bangku cadangan. Dia masuk di menit ke-53 menggantikan David Silva. Namun status itu tak meng- ganggu Navas untuk tampil gemilang, dia bermental kuat saat dibutuhkan Spanyol di saat-saat kritis. Bahkan ia kemudian men- jadi juru selamat. “Saya benar-benar percaya diri, itu ada dalam diri sendiri dan dalam tim. Pada saat akan melakukan penalti, saya tidak membiarkan apa pun terlintas dipikiranku ka- rena saya begitu yakin bisa mencetak gol. Dan, un- tungnya, saya berhasil mencapainya,” kata Navas dilansir Pemain yang baru saja menandatangani kontrak dengan Manchester City ini tak menyangkal jika sebelumnya ada perasaan bergojalak pada dirinya saat diminta jadi eksekutor pen- alti terakhir. “Kami bermental kuat dan itulah yang jadi pem- beda,” ungkapnya eks pemain Sevilla ini. Situasi yang dihadapi Navas memang tak semudah seperti yang dibayangkan. Undian menempatkan Italia lebih dulu mengambil giliran dalam babak adu penalti. Penembak pertama Italia, Antonio Candreva sangat percaya diri menyarangkan bola melalui eksekusi ala Panenka. Hingga eksekusi kelima, semua eksekutor menjalankan tugas dengan baik, termasuk Danielle De Rossi yang gagal di Euro lima tahun silam menghadapi lawan yang sama. Saat memasuki adu penalti lepasan, bek tengah Italia Leon- ardo Bonucci yang bertindak sebagai eksekutor ke tujuh men- garahkan tendangannya ke tribun penonton. Pada giliran berikutnya Navas yang keluar sebagai pe- nentu lolosnya Spanyol ke nal pertamanya di Piala Konfederasi. “Ini benar-benar emosional. Sebuah kehormatan ada pemain seperti Navas di tim, dia pemain yang selalu menawar- kan sesuatu yang sedikit berbeda. Hari ini ia tidak hanya memiliki kecepatan tapi mampu mengatasi situ- asi su- lit,” puji bek Spanyol Gerard Pique. Pada pertandingan kali ini, Spa- nyol memang dibuat susah payah oleh Italia. Pelatih Italia Cesare Prandelli menepati janji dengan memainkan formasi khusus meng- hadapi Spanyol, yaitu 3-4-2-1. Antonio Candreva dan Claudio Marchisio menunjang pergerakan Alberto Gilardino di lini serang, sedangkan Christian Maggio dan Emanuele Giaccherini diandal- kan dari sektor sayap. Sementara Spanyol praktis tidak mengubah susunan terbaik tim dengan Fernando Torres sebagai ujung tombak. Meski Spanyol masih mampu melakukan ballposession, tapi para pemain Italia bermain cerdik dengan memanfaatkan ruang ter- buka terutama di sektor kiri dan kanan pertahanan Spanyol yang sering ditinggal dua full back-nya. Akibatnya beberapa peluang mampu didapatkan Italia melalui serangan balik. Sayangnya pe- luang itu beberapa kali mampu dimentahkan Iker Casillas hingga pada akhirnya Gli Azzurri harus menyerah lewat adu penalti. Dengan kemenanngan ini Spanyol akan menantang tuan rumah Brasil di nal Piala Konfed- erasi yang akan dihelat di stadion bersejarah Maracana, Senin (1/7) dinihari.( Candreva Spanyol 0-1 Italia Candreva de Rossi Giovinco Xavi Buffon Xavi Iniesta Piqué Ramos Iniesta Piqué Aquilani de Rossi Giovinco Casillas Aquilani Drama Adu Penalti 1 1 2 2 3 3 4 4 Pirlo 5 Buffon Buffon Ramos Buffon G S Mata 5 Mata Buffon Montolivo 6 Busquets Navas 6 7 Busquets Navas Buffon Buffon Spanyol 1-1 Italia Spanyol 1-2 Italia Spanyol 2-2 Italia Casillas Spanyol 2-3 Italia Casillas Casillas Spanyol 3-4 Italia Spanyol 3-3 Italia Spanyol 4-4 Italia Spanyol 4-5 Italia Spanyol 5-5 Italia Pirlo Casillas Spanyol 5-6 Italia Montolivo Casillas Spanyol 6-6 Italia Bonucci 6 Spanyol 6-6 Italia Bonucci Casillas Spanyol 7-6 Italia Buffon Urungkan Panenka Ramos EKSEKUSI penalti ala Panenka belakangan jadi trend. Tak terkecuali pada saat terjadi adu penalti antara Spanyol dan Italia di seminal Piala Konfederasi 2013. Penendang pertama Italia, Antonio Candreva, sukses mel- akukan tendangan menipu itu untuk memperdaya kiper Spanyol Iker Casillas. Panas dengan atraksi eksekutor Gli Azzurri, bek Spanyol Sergio Ramos men- gaku sejatinya hendak melaku- kan hal serupa, tetapi dia dan rekan-rekan setimnya sepakat mengurungkan niat tersebut karena yang berdiri di hadapan mereka adalah Gianluigi Buffon, salah satu kiper terbaik dunia. Ramos sebagai penendang keempat akhirnya memilih me- nendang ke sudut atas kiri gawang untuk menaklukkan kapten Juventus itu. “Saya tadinya ingin men-chip penalti tapi kami memutuskan tak melakukannya karena kipernya Buffon,” ungkap Ramos usai pertandingan. Di seminal Euro tahun lalu, Ramos melakukan eksekusi ala Panenka kontra Portugal untuk membantu meloloskan Spanyol ke partai puncak melalui drama adu penalti. Keberadaan Buffon memang membuat para pemain Spanyol super waspada. Sebenarnya gawang Spanyol juga dijaga Casillas yang juga tercatat sebagai salah satu kiper terbaik dunia. Pada saat terjadi adu penalti nyaris tak ada yang menonojol ditunjukkan Buffon dan Casillas. Keduanya sama-sama gagal menghalau bola dari 14 eksekutor. Kegagalan Leonardo Bo- nucci bukan karena bola ditepis Casillas tapi karena bola yang diarahkan ke atas gawang. Namun ini tak mengurangi serunya atraksi antara Buffon dan Casillas. Di akhir pertandingan, Buffon tampak mendekati Casillas di pinggir lapangan. Dia mengucapkan selamat sambil meminta rivalnya itu berukar jersey.( JURU SELAMAT - Selebrasi gelandang Spanyol, Jesus Navas, setelah mencetak gol penalti melawan Italia pada babak semifinal di Castelao Stadium, Fortaleza, Jumat (28/6). Navas menjadi juru selamat Tim Matador. AFP PHOTO / VINCENZO PINTO AFP PHOTO / YASUYOSHI CHIBA/JUAN BARRETO /INCENZO PINTO/ LLUIS GENE/YURI CORTEZ KETAT DRAMATIS - Laga Spanyol kontra Italia berlangsung ketat dan berakhir dramatis. Pemain Italia (putih) dan Spanyol berebut bola (1). Tendangan penalti Leonardo Bonucci melayang di atas gawang Iker Casillas (2). Jesus Navas mencetak gol penentu (3). Pemain Spanyol berlarian menyambut kemenangan (4). Pemain Italia tertunduk lesu (5). join follow @portalsurya
  • 20. | SABTU, 29 JUNI 2013 |SoccerHotNews18 soccer hot news18 SABTU 29 JUNI 2013 Tuliskan “kicauan” Twitter Anda baik berupa komentar tentang sepakbola atau dukungan terhadap klub kesayangan Anda ke #Tribunsuperball atau @Tribunsuperball. AdnanTheDanger ?@adnanjack@ TribunSuperBall Brazil memang kuat melawan Uruguay, dia hancurkan Uruguay dgn scoor 2-1. By : Adnan d Rompol E.N.F ?@ eryPASERBUMI @TribunSuperBall makin terkenal aja ni indonesia. setelah belanda ke indonesia,giliran pemain top dunia ke indonesia Syed Muhammad Fuady ?@ saidodi@ TribunSuperBall paling ganteng oscar Bimo Rezpector ?@ BimoRezpector1 @TribunSuperBall I love barcelona,I love Indonesia # VISCHA BARCA SAMPAI MATI! SaddamAlamsyah ?@ SaddamAlamsyah @TribunSuperBall akhirnya spanyol masuk nal piala konfederasi juga semoga juara buat la furia roja daffa arek surabaya ?@ daffa_sby @ TribunSuperBall sebab kemenangan spanyol di peroleh lewat adu pinalty @rismawanto ?@21Rismawanto Smoga brazil yg mjd juara piala konfederasi YOGA FITRIA N ?@galoohh @ tribunSuperBall pengen liat wajah jelek fans spanyol. mungkin Brazil kali ya yang bisa ngalahin spanyol?? #bisajadi SECARA teknis Italia sudah luar biasa. Mereka mempersiapkan laga melawan Spanyol dengan sangat baik. Gli Azzurri tampil sangat bagus terbukti dengan banyaknya peluang mencetak gol yang mereka miliki dibandingkan La Furia Roja. Tapi takdir ternyata berbicara lain. Italia untuk kesekian kali harus menerima kekalahan dari Spanyol meski mereka tampil lebih superior dibandingkan tim juara Eropa dan Piala Dunia tersebut. “Ini sangat buruk dan mengecewakan. Kami menampilkan performa hebat melawan juara Eropa dan dunia. Di beberapa kesempatan dalam laga kami superior,” kata bek sayap Italia Christian Maggio dilansir Football-Italia, kemarin. Maggio menyebut kekalahan Italia lebih disebabkan karena faktor takdir yang tak memihak pada mereka. Ini sangat jelas sebab pemenang kedua tim ditentukan lewat adu tos-tosan yang akhirnya dimenangkan Spanyol. “Sekali lagi takdir tak memihak kami. Sekarang kami akan bermain untuk tempat ketiga kontra Uruguay dengan kepala terangkat tinggi, berharap lain waktu hasilnya akan lebih baik,” lanjut bek Napoli itu. “Kami memberikan seluruh hati dan jiwa kami malam ini. Saya mempunyai kesempatan mencetak gol, tapi bolanya tak mau masuk untuk saya. Saya tak bisa tak membayangkan apa yang mungkin terjadi kalau kami mengantongi keunggulan saat jeda,” tambah Maggio Dengan demikian Italia gagal membalas dendam kekalahan dari La Furia Roja dalam tiga pertemuan terakhir di ajang turnamen besar. Italia disingkirkan Spanyol, juga melalui adu penalti setelah bermain 0-0 di waktu normal, pada perempatfinal Euro 2008. Kemudian empat tahun sesudahnya kedua tim kembali bertemu di ajang Euro 2012 yang berlangsung di Polandia/Ukrainia. Italia dan Spanyol bermain imbang 1-1 di fase penyisihan grup dan setelahnya digilas 4-0 di laga final Euro 2012. “Spanyol tetaplah Spanyol, tapi kami memiliki determinasi ekstra selama 120 menit. Seperti biasanya, kami mempunyai problem pada adu penalti, tapi kami berada di jalur tepat,” tandas Maggio. Penyesalan yang sama juga diungkapkan Giorgio Chiellini. Menurutnya, Italia sudah tampil gagah berani dengan mengajak Spanyol main terbuka. Padahal itu tidak sesuai dengan “tradisi” Italia yang biasa menerapkan permainan tertutup dengan sistem pertahanan gerendel atau Cattenacio. “Kami tidak bermain catenaccio, karena kami menciptakan beberapa peluang mencetak gol dan memindahkan bola ke beberapa tempat. Kami tentu kecewa dengan hasil ini setelah kejadian di Euro,” katanya. Tak mau terlalu ikut arus dalam kekecewaan, Italia lalu menatap laga selanjutnya menghadapi Uruguay dalam laga play-off untuk memperebutkan posisi ketiga turnamen Piala Konfederasi. “Sekarang yang terpikirkan adalah mempersiapkan pertandingan lain dalam dua setengah hari. Masalahnya suhu udara di sini sangat panas. Rasanya seperti penyiksaan. Penyelenggara harus melihat jadwal dan mempertimbangkan kesehatan para pemain,” keluh Chiellini. Faktor suhu udara panas dan kelembaban memang menjadi keluhan para pemain Eropa selama perhelatan Piala Konfederasi. Ini tentunya berpengaruh terhadap daya tahan para pemain yang biasa dengan cuaca dingin. Situasi makin menyiksa saat pertandingan dilanjutkan dengan babak tambahan waktu selama 120 menit seperti yang terjadi pada laga Italia kontra Spanyol. ( Takdir Memang Kejam! ANDAI saja eksekusi penalti yang dilakukan Leonardo Bonucci sukses, nasib Italia mungkin takkan seperti sekarang. Sepakan Bonucci yang ditunjuk sebagai eksekutor terakhir Italia melambung tinggi ke angkasa dan menyebabkan Spanyol akhirnya menang adu penalti. Memang ada sebuah penyesakan terjadi ketika salah seorang dari eksekutor gagal melakukan tugasnya. Tapi bek Italia Giorgio Chiellini memaklumi kegagalan rekannya itu. Dia mencontohkan apa yang terjadi pada Italia bersama Roberto Baggio. “Saya mencoba berbicara dengan Bonucci, tetapi tak ada kata-kata yang bisa membedakan saat ini. Dia tidak beruntung saat mengemban tugas dan seharusnya itu dihargai. Jika Roberto Baggio bisa gagal di final Piala Dunia, maka siapa pun juga bisa,” kata Chiellini. Italia memang menangis saat Piala Dunia 1994. Mereka kalah dari Brasil setelah tendangan penalti penentu yang dilakukan Baggio saat itu gagal. Padahal Baggio adalah penyerang tajam. Tumpulnya lini depan Italia ketika menghadapi Spanyol tidak terlepas dari ketiadaan Mario Balotelli yang biasanya jadi penyerang utama Gli Azzurri. Balotelli absen pada laga ini karena mengalami cedera dan dipulangkan sehari sebelum laga berlangsung. “Semua orang berbicara tentang Mario Balotelli, namun Alberto Gilardino telah menjadi titik referensi selama bertahun-tahun dan gerakannya membantu tim. Dia tidak beruntung sehingga gagal mencetak gol, karena ia biasanya cukup bagus,” tambah Chiellini. Pada akhirnya Chiellini menyimpulkan Spanyol memang masih dinaungi keberuntungan. Tapi di satu sisi dia juga membanggakan perjuangan timnya yang berjuang habis- habisan hingga titik darah penghabisan. (Tribunnews. com/cen) Memaklumi Bonucci seperti Baggio JOSE Mourinho dituding sebagai penyebab rivalitas antara Barcelona dan Real Madrid menjadi semakin tegang sejak kedatangannya. Namun demikian hal itu tidak membuat seorang Lionel Messi kehilangan respek. Secara pribadi, Messi bahkan mendoakan Jose Mourinho bisa meraih sukses bersama Chelsea. Berikut ini petikan wawancara Messi seperti dikutip dari Sky Sports di sela-sela kegiatannya di Saly, Senegal, sebagai bagian dari proyek Aspire Academy’s Football Combating Malaria. Real Madrid akhirnya menunjuk Carlo Ancelotti sebagai pelatih baru mereka. Sepertinya Barcelona tidak akan menemui kesulitan berarti karena sudah tidak ada Jose Mourinho. Saya rasa Liga Spanyol sangat sulit dan akan terus demikian. Kami akan bertarung melawan tim kuat dengan pemain-pemain hebat seperti Real Madrid. Mourinho adalah pelatih hebat namun kami tahu Ancelotti juga sama bagus. Saya rasa Mourinho juga akan meraih sukses di Chelsea karena dia adalah pelatih hebat. Barca akhirnya berhasil mendapatkan Neymar setelah mengejar cukup lama. Banyak orang yang menilai Barca akan kesulitan untuk menggabungkan anda dengan dia. Apakah betul demikian? Saya tahu Neymar adalah pemain hebat yang akan memberikan banyak hal kepada Barcelona. Semoga kami bisa bermain bersama di Barca. Tentu dia bisa berkontribusi banyak (buat Barca). Semoga dia bisa melanjutkan apa yang ditunjukkan di Brasil saat sudah berada di sini. Dengan kehadiran Pep Guardiola di Bayern Muenchen, apakah itu artinya mereka bisa mematahkan dominasi Barcelona dia Liga Champions? Era kebangkitan persepakbolaan Jerman? Kami memiliki tim dan pemain-pemain hebat, seperti yang telah kami perlihatkan selama beberapa tahun. Kedatangan Guardiola akan membuat Bayern semakin kuat. Menjuarai Liga Champions selalu sulit dan target kami adalah berusaha memenangkan semuanya dan meraih sukses di semua kompetisi. Anda membicarakan Jerman mendominasi persepakbolaan belakangan ini, saya tidak tahu apa yang terjadi pada masa depan. Saya tahu Jerman memiliki sejarah tim-tim hebat di persepakbolaan dunia di level tim nasional dan klub. Menjuarai Liga Champions sulit bagi semua tim, meski mereka dari Jerman atau Spanyol. Anda selalu dianggap tidak menunjukkan penampilan bagus di klub bersama tim nasional. Anda pun belum pernah memberikan trofi untuk Argentina. Jika Tuhan menghendaki, maka kami akan menjuarai Piala Dunia. Kami masih memiliki waktu setahun dan kami harus berkembang. Masih ada sejumlah hal yang harus dibenahi namun saya rasa kami masih punya waktu. Kami harus meningkatkannya dan tentu saja ini adalah mimpi kami untuk menjuarai Piala Dunia. ( wawancara Lionel Messi Saya Doakan Mourinho Sukses Skuad Azzurri Tampil SuperiorItalia Tak Pantas Kalah Ulasan Del Bosque Berjalan Seimbang INI adalah penampilan hebat dan Italia tim yang sangat kuat yang pantas mengambil keunggulan di babak pertama. Sementara laga terus berjalan kami lebih baik dan pantas dengan kemenangan di perpanjangan waktu. Emmanuele Giaccherini sangat impresif, demikian juga dengan Christian Maggio dan Andrea Pirlo. Prandelli pantas mendapat kredit atas permainan cepat dengan menurunkan Maggio dan Giaccherini. Karena kinerja mereka membuat Spanyol benar- benar dalam tekanan. Selama pertandingan berbagai hal berjalan seimbang dan Italia terlihat mulai lelah, yang mana memungkinkan kami untuk keluar dari tekanan.(cen) *) Vicente Del Bosque, Pelatih Spanyol, dilansir Ulasan Prandelli Penampilan Hebat KETIKA Anda mendapat adu penalti, apa pun bisa terjadi. Kami memiliki penampilan hebat dan dalam kondisi itu sejak awal hingga akhir, menciptakan banyak peluang mencetak gol Spanyol berada di atas kami karena mereka bekerja dengan konsep ini selama bertahun-tahun, sementara kami masih mencari pola. Dalam hal karakter, determinasi dan taktik, kami mengalami peningkatan. Kondisi udara disini tidak masuk akal, karena tidak mungkin kami masih memiliki energi setelah main 120 menit. Para pemain benar-benar mengharukan dalam cara mereka berjuang hari ini.(cen) *) Cesare Prandelli, Pelatih Italia, dilansir football italia AFP PHOTO / TOUREBEHAN JUMPA PERS - Bintang Argentina dan Barcelona, Lionel Messi, memberi keterangan saat jumpa pers di Mbour, Senegal, Jumat (28/6). AFP PHOTO / YASUYOSHI CHIBA DUEL - Gelandang Spanyol, Javier Martinez (tengah), berduel dengan bek Italia Christian Maggio (kiri) dan gelandang Alberto Aquilani pada laga seminal di Castelao Stadium, Fortaleza, Jumat (28/6). Maggio sebut Italia tampil spektakuler. EL SHAARAWY - Direktur olahraga Fiorentina Daniele Prade menampik laporan yang mengklaim Stevan Jovetic bisa bergabung AC Milan dalam paket pertukaran dengan Stephan El Shaarawy. Pertemuannya dengan Adriano Galliani tidak untuk membahas rencana itu. OSVALDO - Penyerang AS Roma Pablo Osvaldo tengah bernegosiasi dengan Atletico Madrid terkait kemungkinan transfer senilai 18 juta pound. Osvaldo sudah tidak betah di Roma menyusul musim yang buruk sejak dua tahun lalu. FRED - Shakhtar Donetsk berhasil mendapatkan striker asal Brasil, Fred, dari Internacional di bursa transfer musim panas ini. Pemain 20 tahun itu tampil memesona di musim lalu dengan tujuh gol dan assists dari 33 penampilan di kompetisi domestik Brasil. (cen) KIPER sekaligus kapen tim nasional Spanyol Iker Casillas mengakui adanya keberuntungan yang menaungi Spanyol setelah mendepak Italia di seminal Piala Konfederasi. Kiper Real Madrid ini menegaskan adu penalti yang dijalani seperti undian. “Penalti adalah lotre dan kami beruntung memenangkannya,” ujar sang kapten usai pertandingan seperti dilansir Casillas pantas menjadi man of the match di pertandingan ini. Dia mampu menggagalkan serangkaian usaha para pemain Italia yang ingin menjebol gawang Spanyol. Di babak pertama tendangan Emanuele Giaccherini melebar saat memungkas serangan balik Italia. Sundulan dari Christian Maggio menyambut tendangan penjuru Andrea Pirlo melayang ke atas mistar. Italia lalu terus memberikan ancaman. Alberto Gilardino, Daniele De Rossi, dan Claudio Marchisio bergantian meneror pertahanan Spanyol. Puncaknya, peluang terbaik Italia terjadi di menit ke-34. Umpan silang Giaccherini ditujukan ke arah Maggio yang berlari tanpa kawalan di tiang jauh. Sayangnya bola dapat diantisipasi Casillas dengan sangat sempurna. Casillas untuk kesekian kalinya masih menunjukkan kelasnya sebagai kiper papan atas. Dia tampil cemerlang seolah tak terpengaruh dengan predikat kiper cadangan yang baru-baru ini diterimanya di Real Madrid. Kini Casillas pun menatap laga nal menghadapi tuan rumah Brasil. “Minggu nanti kami akan bermain melawan tim besar Brasil. Kami harus melakukan yang terbaik untuk menang,” pungkas Saint Iker. ( Casillas Akui Keberuntungan Spanyol AFP PHOTO / LLUIS GENE IKER CASILLAS AFP PHOTO / YASUYOSHI CHIBA SEDIH - Bek Italia, Leonardo Bonucci, sedih setelah gagal menjadi eksekutor penalti. Soccer Short join follow @portalsurya
  • 21. SABTU, 29 JUNI 2013 SURABAYA MOBIL DIJUAL BMW BMW 320i ‘94 (B) VR-17 merah met ori ex kedutaan 30jt%70922931(lakarsantri) 971398 BMW 318 Htm 2001 VR17 A/T 108Jt bs opr Cpt Dpt sbybrt%087853155551-70995549 972049 BMW 318 TH’02 HITAM MET STNK BARU +ASS Sgt istw Rp.135jtnego Hub:031 70277881 972528 BMW 318i Th’96 Istimewa 75Jt Nego hub:0819 3914 9000 Sidoarjo 972775 CHEVROLET SPARK LS ‘2003 Bgs ac/tp/vr/pw/ps/em/cl 57jt pakis Wtn 5/22 %0815 5363 5107 971761 CHEVROLET’82 5Pintu Surat+Ac Baru 30Jt Hub:%031-71952969 Spj 972034 CHEV TROPER 4x4 Diesel 85 Long Chasis Ban 31 Putih Faktur Ada %085257070804 972774 DAIHATSU Promo Astra Xenia Dp26jt Terios 29jt PU10jt Luxio 26jt Sirion 27jt%81058081 969070 PROMO JUNI BELI XENIA GRATIS XENIA ,DisconBesar2n%Fifi:72976664/0821268 27211 970860 CLASSY’92 SALON AC/TP/VR/PW/PS W- Grsk siap pake 35jt % 70279049 971352 GRAN MAX Pick UP 1.5 Th’2008, ESPASS Pick Up Th’2004 %8536737 -081234372255 971358 ZEBRA BODY ASTREA’93 PUTIH Ac/tp/vr interior oris bagus terawat:03170612976 971395 TARUNA FGX’03 EFiBIRUMETIstw(W)SDA Audio/TV.PRIBADI%71472212/08565540 9412 971401 ESPASS’96Ac/Tp/VrUngu Hub:Nginden V/5A %70105011 971440 ZEBRAFamilyvanTropeerJumbo94/93Vr/ Tp +Espass’96 H:Nginden V/5A%70105011 971421 XENIA Li Family’09 Htm TgnI(W-SDA) Semo lowaru Utr VI/5%70998169 (110Jt)BsTT 971450 ESPASS’97(1.3)Hijau AcDblRtWD Sgt Ist 42JtNg,Penjaringan Tmr18 Rkt%70987456 971400 TAFT GT’92 MsnBodyCatIst AcVrBsrRmt Audio KcSpionElct Spoiler(L)Htm71702417 971492 ESPAS PU’04(L-Sby)Istmwa KIRSTNK Baru An.Sdr BU 39Jt%71405678/0812170 05678 971448 HIJET 1000’86 Stw,Troper 86,Htm,Trwt, Siap Pkai.Lebak Timur Asri 17%71293901 971497 PROMO ASTRA XENIA DP27jt@2,7jt,Gmax DP10jt@2,3jt Ready,BsTT+hadiah%71433 990 971490 HIJET1000 th’84 (W-Sda)Sgt Istw Bonus Star88=13Jt saja.SukodonoSda.71833349 971446 DIJUAL CPT TARUNA CL’02 Biru Gelap AC/ Accu Baru (W) 85Jt Hub:082139813330 971528 TAFT HUNTER ‘84 AC/PS Disc Break Pajak Baru 4x4 Full Ist %0812 1696 9272 971590 C.WINNER PRO’94 Abu2TuaMet PW/CL/ EM/VR15/RMT/ALARM/USB/DVD 45jT H:91037954 971503 ZEBRA PU’92 MSN Halus/Tdk Kropos Bak- Bordes Bagus 21jt%77448378-08133155 7530 971624 TAFT GT’97 IndpTg1(L)Antk SptBr ROCKY ’95 OrsKm68rb SptBr KrdSIMAS%92122112 971469 ZEBRA Pick Up’88IstwHitam(L)Pumpun- gan V/50 Dkt UNITOMO %082142597144 971682 XENIA Li VVTi’08 Silver(N)102jt,Anggrek Mas,Dkt Pintu Tol SDA %08123614861 971744 SEDAN CHARADE (L) ‘85 Biru Super Irit Banbaru26jtNg%081230242301-72687201 971754 FEROZA’98 Independen AcTpVr BanBaru 71jtNg Rkt Mngl Ky.Satari 4/47%71317865 971807 TAFT GT 4x2’89 HijauAktif semua 52Jt Ng Sidokare Asri AH11 Sda%081216555999 971811 XENIA Xi DELUX 2011 PajakBaru Cash/ Kredit %03188265530 TmnPondok Indah RX/6 971973 XENIA MI Pmk 2006 Silver (H-Smg) 85JtNg Kedinding Lor %081332737675 971989 HIJET 1000 Station’84 Istimewa Velg Rac- ing 10JtNg%031-77494057/085257938289 971956 ESPASS th’04ZL AcRtVr60Jt CLASSY ‘93 AcPsPwEmVrAud37.Kredit Ok.%031 88286555 971832 XENIA’2010/2009 Li SPORTY hitam Tgn1 Km.20rbn 95%Baru%70760988/0813578 67099 972100 ESPASS PU th ‘96 Kond Bagus Siap Pakai 29Jt NG. Hubungi: 081216535569 . 972097 ZEBRA ASTREA’95 5Pintu Ac/Tp/Vr OriCat 34JtNg SidokareAsri AG1 SDA%70645262 972059 ZEBRA 1.3’92 Ac/Tp/Vr L Merah Mulus An Sendiri Siap Pakai Hub:%085231812248 972069 ESPASS’03 Tgn1 Semi Box Alm Tp/C.Lock/ Remote,Petemon Barat 160 %71482908 972074 DAIHATSU CLASSY’94(L)Hijau Met Mulus Siap Pakai Ac Dingin 38,5Jt %70713025 972047 ZEBRA’95 6Speed FamilyFan(W-Sda) Ac/T/ Vr 4Ban Br istw %77835432-08239224900 971959 GRAN MAX PU’11 Ac/Ps 82JtNego Bs TT/ Krd Jl.Jolotundo Baru 3/1 %70160074 972079 MURAHALLNEWXenia’12Silver(L)drBaru M Deluxe Lengkap Ori%71600605 Nego 971845 ESPASSTH’97An.SendiriAc/Tp/VrHrg:38Jt Raya Nginden 71%031-34220306 971893 ESPAS’03+04 Silver AcTpVr No.Baru Krtja- ya 8A/4%71269638/081236543839 Bs Krd 971933 CLASYPRO’94/95BiruMetAntikOrsSprIstw 47,5Jt%71269638/081236543839BsKrdt 971930 CHARMENT’83BagusSuratHidupL-SbyAcT- pVr 18jtNg%031-83465753/081615223017 971991 CHARADE PMK ‘82 AC/TP/VR15 MERAH SGT BGS POOL 15,5JT %031-72153247 BU 972037 ESPASS ‘03 PU. Harga 37 Jt. HUB. JL.AMIR MAHMUD 71 G.ANYAR. %03170728607 . 972153 *TAFT GTS th ‘90 Blit Harga 45Jt Nego* Hubungi: 081235081238 / 081515426869 972202 XENIALiDlxPlus07Htm(L)PjkBrORIL/Dlm 103pas.Waru 34680484/082143762488 972207 ESPASS’97 PICK UP Surat Baru(L)AC/TP. TngglisMjoyo Gg.Botoputi No.5% 72348554 972175 Xenia’09 Li Sporty Hitam 111jt pajak April Cat Asli%71996568 - 087854586061 972631 ZEBRA ‘93 Troper AC DBl Abu2 Brg Bagus 27jt Nego %031-81700819/081235542270 972272 ROCKY’97 INDEPENDENT 4x4,hitam,W, Ban30 ,AC,CD hub:081230815607 972851 TAFT’87 4X4 BAN31 VR.CD.AC.CL 50jtNE- GO.Prum AL Blok F7/6.Candi-SDA 72120186 972404 TERIOS TX Pmk 09 A/T (L) TG1 dr Baru Hi- tam Km77rb Sgt Istimewa.%03170122400 972387 ZEBRA th’94 BODYTECH AC/RT/VR Mu- lus W-SDA 25jt.NEGO%0810511756-031. 71351231 972401 ZEBRA ‘95 Bdy Pjg Mulus Ac/Audy Tgn1 mesin Sip 30Jt.03177028299. Siap Pakai 972393 ESPASS 1.6 (W)‘96ACdbl/TP/VRHijauMet 42jt Nego %72484734/085781092369 972570 ZEBRA 91 TROPER BiruMet Bagus 22,5jt Nego Babatan Pilang 5/27 BU %83653379 972758 XENIALiVVTi’09HitamOrs Istw tgn-1 Hub:0852 3063 1569 972616 GRAND MAX PU’10 (1.5)62Jt BU Cpt Del- tasari Blok V/9A %081331716169 972864 Espas Boxalm 96.Antikarya L.Hitam. Mnyar Krtaadi 7/22.%92347907 972925 XENIA MI’04(W)SILVER Ors L/D AcDgnTP/ Vr Ors 79JTNG;Ry GregesBrt 30%79650162 972930 *ZEBRA’90 PICK-UP 12.5JT+CARRY’87 PICK-UP 15jt.Darmokali 20 Tlp:03171412284 972514 Espaspu2004htmistimewa w(grsk) 44jt/ng %71967942. 972908 XENIA Xi 1.3 Family’06 VVTi MerahBsKrd Dp25jt GryKbraon Brt CG-13A%70184878 972801 Xenia xi’04 DLx istw=102jt +Li dlx 08 htm =108.5jtBeji%70360906/081332091113 972824 ZEBRA Espass 1.3 PU ‘2003 Istimewa Mu- rah Rm Zona Alam %085707000779 972823 Zebra’91 Hijet’86 AC Dbl/Tp/Vr An.Sdri J.Slh Satu RungkutLor VI/34%70409943 972883 ESPASS1.3Th’1997Silver Kondisi Terawat Hub:71503554 972760 CHARMAN ‘84 (L) PS,AC,TP,VR Merah Teri- ma Srt br 18jt%88296634/082332907671 972756 ZEBRA’89,Corona TT’80 (12) Jl.Hangtuah Sblh Klenteng Sda H:71910570/8953525 972777 TAFT GT ROCKY 4x4 Th’93 Istimewa bisa Kredit.Jl Pahlawan 15 Sidoarjo 972796 ZEBRA PU’95 Bd Kaleng Siap Pakai 23JtNg Rkt Menanggal 22 %77111004 972742 Terios TX’07; Kia Visto ‘01Matic. Plat L Ter- awat %031-8282308;083849434077 972506 *TAFTINDEPENDENT’96GREY4X4AKTIF Bdi Klg ban 31(L)istw H:082.131.650.999 972510 ZEBRA ‘91 (W-SDA) PAJAK BARU ABU-ABU ORS CAT ISTIMEWA%72078397-0812166 57114 972829 ESPASS ‘97 1.3 Sleding Kond Ors Cat Ac Din- gin Ban Baru %031-7234 4671 SDA 972832 GRANMAXTypeD2008 GriyoMapan AD-20sda%08175115601 972764 “PROMO LEBARAN” XENIA DP:25JtAn Angs: 2,5Jt Kesempatan Terbatas%031-702 52 108 972504 PROMO DAIHATSU Xenia Dp18Jt Terios Dp19Jt,Sirion DP25Jt78047822/08564818 7386 972515 PAKET RAMADHAN DAIHATSU New Xenia AB;Terios;Sirion;Luxio;Dp.20-An Juta- An;G.Max PU Dp.10Jt%88272733/0813351 61566 972706 HIJET1000PodojoyoTroper’86TR/Vr14,5Jt Ng;Brig.KatamsoI/161%72125269 Waru 972556 XENIA Xi 1.3 Deluxe Plus’09 PjkBaru Km- 60Rb Hrg113JtNg%72340506/087854055 561 972486 XENIA’200585Jt+PantherLSHigrade’2003 Turbo 115Jt Jl.Sidotopo Wetan 20-A 972475 ZEBRA ‘91 Bodi Astrea Mulus Orisinil Super Istimewa S.Pkai 25Jt %88152759 972947 XENIA Li’05 AC/P.Stering/PW Istw 96Jt Krd 4Th, Dhrmawangsa 124%082131255262 972487 CLASSY’95 Ac/Cd/VrPwPs OrsLuarDalam BanBaru Istw MesinBgs 41JtNego%8121 5129 972440 FIAT FIAT BRAVA 1.6 th’84 ISTMW TG1 ac antik 35jtNg jl.manyar dukuh 27A%70253682 971737 FORD FORD EVEREST 2.5 L XLT 2WD Th’2006 HargaNego%081.232.939.350 971480 FORD FIESTA A/T’2010 Putih 30Rb KM BsTT/Krd;RyMstripKdrs14%7664215/701 20653 971689 FORD LASER ‘97 Kondisi Bagus,Ac Dingin,Tip,Vr,4Ban Bagus %7181 5116 972606 Ford Laser’98pmk hitam (w) ex taxi mer- pati interior jok ori 19jtNg%70136644 972887 FORD EVEREST’04 AT (L) Coklat VrAc Double (155JtNg)%031-71820605/081 231 623 545 972478 HONDA JUAL H.PRESTIGE89Hrg35JtNGIstimewa. Corola DX80 Hrg 22Jt NG%083831066161 971377 JUAL CRV ‘04 MATIC Hitam/STNK baru di- jamin kondisi Terawat.Hub.031 71581525 971393 H ACCORD Th’82 Sangat Prima AC Dingin/ TP/VR15 Khusus Penggemar 28Jt Nego. Jl: Taman Apsari 11 Sby (Joko Dolog) 971426 JAZZ’04 Manual Htm An Sdr Pjk Baru Ors- inil Luar Dalam%70998169 (113,5Jt BU) 971434 HONDA CIELO Merah’94 Ac/Tp/Vr16 Pas 56Jt Hub:%081235429154/031-70361063 971475 Honda BRIO-E Matic 2012 Putih Ors Km- 11Rb D-CARE Mulyosari 173 T.08819022769 971439 NEWCIVIC2001VTI-S Warna Silver Hub:081235462771 971565 HONDA MAESTRO th’90 A/THitamMulus harga 42jt siap Lebaran.081.901.8888.46 971442 CIVIC WONDER ‘86 AC TP Vr (L) Biru jl.Ry. Rkt menanggal 22%81236557/71014445 971616 JAZZ’06 Hitam M/T (L) Sgt Bgs Istw Bisa TT/ Kredit Hub:72447948/081615438382 971500 Jual HondaEstilloWarnaPutihTh94Hub.0 85230269814/08993650591 971631 HONDA CIVIC’83 SrtKomplit mati,mesin mati 7jt,hub:03170056003,081330654460 971675 JAZZ RS AT’10/08 KM65rb FullAudio BsTT/ Krd;RyMastripKdrs14%7664215/70120653 971691 CIVIC WONDER’84 Ac/Tp/Vr Mulus Ry Tenggilis Mejoyo KB-14 %72153329 971694 FREED PSD’12Abu2 MetVCOOL+GPS+Cam- era Parking,Tg1,KM10rb Isi Selalu Pertamax- Plus Mlk Dr %082230024159 971723 PRESTIGE’87 AcTpVr Dalam Orisinil 25jtNg RktMngl Jl.Ky.Satari 4/47%71317865 971950 Civic Nouva Pmk 91(S~Mjk)Hijau toska AC,EM,Audio,Vr.Hub:081230256664(bs TT) 971795 **MAESTRO’90 APPLE GREEN ORI Ac/Tp/ Vr/Ps/Pw/Em/CL konds S.Pakai:031 8166 1680 971884 JAZZ IDSI’05 MaticCoklatMudaMetBrgBa- gus 110Jt.PakisTirtosari88%72574292 971864 NEW CRV’03 Matic Silver Jok Kulit Brg Ba- gus 130Jt.Dukuh Pakis 4/18%70686060 971853 JAZZ th ‘05 Manual Silver Stone Km71rb 125Jt.Dukuh Pakis 4/18. %03170147118 971846 GENIO’94 Abu2Tua Metalik Istmwa% 081703337453/81114404 Jl.Ketintang Brt No.3 971907 H.STREAM’2002Matic1.7Abu2Met(L)110 JtNego Hub:031-31050355/081 946546547 971913 PRESTIGE’87 Hitam Ac/Cd/Vr Hrg:33JtNego Hub:031-72900487 (No.Sms) 971936 HONDA NEW CITY ‘2004 IDSI Biru Muda Hb:M.Tirtoyoso Utara III/15%08155140052 972152 HONDA GENIO ‘93 Biru 63jt Buduran Dam- arsi Ruko No.22 %031-3139 8570 P.Supri 972671 JAZZ ‘2004 VR18 Ful Audio TV Terawat 109jtDukuhKupangTimur12/3%71206540 972287 CIVIC ‘76 VR MSN, CAT SGT BGS N-Mlg 11jt. Pondok Jati AS-3 SDA. 03177357128 972381 MAESTRO’90 INJECTION 4WS 43jtng+ GRAND CIVIC’90 Audio 45jtng Hub:031 72529442 972945 J.HONDA CITY’96 Biru Met Ac/Tp/Vr Hrg 63Jt Hub:%031-70801953 972296 CIVIC WONDER’85 22Jt+CIVIC Excalant’83 17Jt Jl.Nginden IV/35 %70825087 972793 GENIO’92 A/T h.53Jt Hub:Kendang Sari YKP VII/15 %88080919 972787 CRV’03 MATIC Htm PjkBr Ban Br Audio TV H:126Jt Ng P.Jati BG/1 Sda %71200166 972323 CRV A/T ‘01 Modif Full Audio TV R17 cck utk Anak Muda.90Jt. %03171812081. 972973 GENIO’93 (L)T AcAudio CD MP3 PwPs VR16 +BanBr IntOrs Hijau 64jt%72485404 SDA 972782 MAESTRO’93 Pajak Baru Siap Pakai H.55Jt Hub:%081703133414 972432 DJLCRVTh’2005MaticHitam(W-Sda)160jt Nego %031-34048262/0857 3330 0890 972374 HYUNDAI GETZ AUTOMATIC’04(L)Slver PjakBaru AudioSet+TV Betul2 Sgt Istw%087852796 805 971589 J.s1 BU Cpt! ATOZ GLS’04 MerahTERIOS’07 Hitam Met Vrc%03170103880-70470084 971494 HyundaiVerna02 AcPsPwEmAudTvOriT- tl69Jt TIMOR97SOHC AcPsPw39Jt KrdtOk 88286555 971809 ATOZ GLS ‘2000 Silver Istimewa %031- 71083930 /083856747473 Harga: 64jt Nego 972019 ATOZ’2003 Merah ORS Lr DLM 71jtNG Rkt Menanggal Jl.KY.Satari 4/47 %71317865 971982 ATOZ’03 GLX Orsinil Cat Total Ac/Tp/Vr Semolowaru selatan I/28 %70589524 972879 ATOZ GLS’2000 w-sda SILVER ORSINIL brg bgs 65 jt %72087675 tanggulangin sda 972761 ATOZ GLS’2001(W)Ac/Tp/Vr/Pw/PsLrDlm Bagus Merah OrsCat 65Jt 70731975 SDA 972894 ISUZU NEWHIGRADETH2000 Hub: %08 214 0022 923 971415 PANTHER LM Smart’05 Silver TgnI 110Jt Ry Kedung Asem 11 Rungkut %71345440 971410 NEW ROYAL PMK’2000(L)BIRU MET ORS AN.SNDR AC/VR 88JT NEGO %08123143442 971600 PANTHERHI-GRADE’96Biru(L)SiapPakai (69,5Jt) %082142410702-031-7247 7429 971485 PANTHER ROYAL 2500cc TH 98 Biru: Plo- so Baru 12. Hub:03170690475-0818513028. 971493 PANTHERLS‘2001LengkapBiruMetSTNK Baru Sangat Istimewa %03188139918 BU 971558 P.HIGRADE 96 BiruMet Ac/Tp/Dvd/Vr jok ori pjk bln4(L) 70818854/087856666909 971726 PANTHER LV’01 BiruMuda AC/TP/PW Citra Garden C5/12 Sda%72050880-085730998 880 971806 ROYAL’97 Merah (W-Sda)SNTK+Pjk Baru 66JtNegoH:Krian70070023-085231969910 971818 GRAND ROYAL’97 BiruTua PjkBr IntrOri MsnSehat BD CatMlsCiamik 77Ng%7085 7199 971954 PANTHER Royal’97 L Pajak Baru Hijau Hub:%03131110333/70104711 972063 NEW PANTHER LV’08 Turbo Biru W-Gresik Tgn1(141Jt)Petemon Brt160 %0818320459 972072 NEW Ptr Kpsul MT pk’02 L tg1 pth+New Ryle+’01 L tg1 Jl.Wonoayu4sby blksutos 972030 PANTHER MODEL MIYABI’95 AcDbl/RT/VR SgtBgs Trwt,Manggis 8/651 PCI%72812458 971994 PANTHER ROYAL TH’00 AC DOBEL,TP,RC Biru Met 75,5jt NEGO. Hub: 085236339731 971827 PANTHER PPL’94 AcDbl.TP.VR Biru L Trm An.Pembeli 55JtNg,Sulawesi 1%72388575 972136 PANTHERPPLTh’93ORILDAC,RT,VR,PS. Harga 56jt. HUB.087853333910 . 972151 ISUZU BYSON 4RD’93 FulBoxAlmini Kond Istw.Kps.Gading Madya 3/38%71211174 BU 972292 ELF 4Roda’97 FulBox OrsCat Bagus 68jt Nego Dukuh Kupang Timur 12/3%71206540 972741 Hi SPORTY’97 AC Doble/VR/PS/PW Pajak Baru Siap Pakai H=79Jt Nego %77289838 972714 ISUZU NKR 71 Th’2011 Pth Tangki Mnyak Grng Hub:081931502184 082150866484 972567 KIA KIASPORTAGE’00AT4WDIstwTgnKe1Jrg Pakai Hub:%77776245/081939190063 971571 CARENSIIstimewa‘2001AC/VR/TV/DVD %031-71393738/087754201683 971583 CARNIVAL GS’2000 Plat B Mati,orisinil, BPKB Hilang 23,5jt %031-71997009 971762 Kia Picanto”05 M/T Htm Full Oftion Spt Baru 89.5jtNego.%7386035/0811351148. 971999 KIA ALL NEW PRIDE th’2011Silveristme- wa hub:031.7183.3099-085.335.882.999. 972089 CARNIVAL’00DslATBiruTg1ElektrikJalan Ori Tdk Kecewa Hub:031-72160211 971903 KIA Carrens 1 A/T’2000 Km80Rb Crem Two+one color FullOriginal % 0813300 98969 972057 CARENT PMK’01 A/T Ors LrDlm Audio Ac Dgn DeltasariIndah BO-12%0856 0722 7947 972283 PICANTOTh.2004FULLVARIASI Oren,harga 73jt hub 71229362 972897 CARRENT II Th’2006Abu2 MetW-SdaKon- disi Sangat terawat Hub:081 8508 121 972757 JUAL CEPAT GEELY Sedan 2010 1.5cc Tgn1 Sunrof,Airbag %21001339/08883701780 972780 MURAHALLNEWPicantoDp35Jt/Angs2Jt Bs 6Th+ Disc Puas %77416542-71975353 972977 MAZDA *****MAZDAMR’92MERAH(AE)AC**** tp/vr/audio/CD 17jt Hub:(031)78450419 971470 DJL CPT MAZDA 323 Th’88 NoPol-DK Putih %085241110913 (Bs Bantu Cabut Bendel) 971548 MAZDA 808 Putih Orsinil ‘75 11jt Jl.Bratang Gede I/54 %0813 5711 7787 971617 MAZDA Interply ‘97 Ac dingin tp Vr16 siap pakai 31jtNg hub:085730515153 SDA 971728 MAZDA SEDAN 323 Familia DOHC Th98 Tp/ Ac Ban Baru Baratajaya 19/5 %70583104 971961 MAZDA HB 323’85 Plat-N Ac/Rt/Vr Luar Dalam Bagus 25,5JtNg %77367353 971965 MAZDA Vantrend’95 OrsCat/Tgn1 Km100 Rb Silver Ist PjkBaru Penggemar%77761599 972061 MAZDA 323’87/90 (L)Ac Dgn Cd/Vr/Pw/Ps Istw Hitam 26.5jtNg %8544808/70048548 972011 MAZDA626 CAPELA HESBACK’90 (L)Ac TpVr PsPw Ors Lr/Dlm 30Ng%031-71800 696 Krian 971979 MAZDAVANTREND’97AcDingin/Tp/Vr/Br Cat Msn Bgs 24Jt,Nginden IV/31%72009405 972991 MAZDA 323 Th’88 Hitam Plat-L Pajak Baru Orisinil %081235246963 972737 MAZDA323Intrply97AcVrDvdBdKlgSlvBgs AnSdr (L)% 03191955056/085335345278 972841 MERCEDES Mercy New Eyes E 230 Clasic Th2000 Ba- rang Istimewa %08123548125/71361661 971001 MERCY C180 TH’95ManualIstimewa4Ban Baru 71JtNego %77148076-081233404075 972078 MERCY 280 Th’75 AC/VR Kuku Macan/PS Sunroof Hub:88296634/0823 3290 7671 Sda 972797 Mercedez BENZ MINI 200 ‘1973 CAT BARU/AC/VR16/ istimewa.Hub: 0878-5253- 0456 972674 C200’96 Pmk’97 (L) Hijau Metalik Hub:031- 7001 5166 972474 MITSUBISHI L300 PU’05 STN KirBr An Sndri 85Jt Kali Kepiting 11D %087853625542-71421958 971464 COLTTPU’75BiruMudaHrgNego(P)Jl.Wadung AsriDalamBengelFatah%031-91943389 971622 ETERNA’90 DOHC Merah AcTpAudioVr17 PjkMti3Th 35JtNg;AsemJy6/37%0813581 42299 971456 T120SS’(L)96 Tg1 An Sdri FVar Biru 100% BrgBgs S.Pake!! 40Jt Ng%08125230669 971466 KUDA SUPER EXCEED Diesel’2000 AcD- blBlwr HitamSilver 79Ng BsKrd%08123 1671355 971531 Mitsb Col T’80 P.U Body Interior MesinCi- amik..B.Mrs Sel Airdas 26C%78099355 971560 COLT TSS New Armada’2001 Spt Baru 46Ng Rkt Mngal Jl.Ky.Satari 4/47%71317865 971614 COLT T120 ‘81STWTg1DrBruFullOrsAntik Khs Pnggemar (BrgLangka)%92122112 971588 J.GALANT’83 AC/tape 15jt Ng, Hub:Medo- kan Semampir Indah 6/4 %088805216057 971674 LANCER GLXi 1.6 ‘94 abu2 tua Pucang Indah K3 sda%08121689536 BU 971757 MITS GALANT HIU Manual’00(L)Hitam Isti mewa Pjk Baru 90Jt Nego %081 3311 42470 972002 T120SS10.77Jt PANTHER96.48Jt ESPAS 04.40Jt All PickUp PjkKirBr.KrdOk88286555 971812 Galant HIU’99 AcPsPw AudTv83Jt,FORD GALA ‘90 PsPwEmAudTv.Kredit Ok 88286 555 971814 KUDA GLS th2000 merah. AC,TP,Velg Rac- ing, PW,Istimewa,B.U. Hub: 03183638328. 971938 GALANT HIU’2000 AT Silver N-Mlg Vr18 Brg Simpanan %81271925 972026 COLT T120 TH’76 Pick Up Jl.Raya Prapen Komplek SMA 16 Gudang Buku Sby 972107 LANCER GLxi(evo3)96 Akhr slvstone AcT- pVr Ngagel Dadi 2a/12%081615010999 Cpt 972083 L300 PU’93 Istimewa Jl.Jolotundo Baru 3/1 %70160074 972076 KUDA DIAMON 1.6 Bsn’03 MerahMet Ors Krtjaya8A/4%71269638/081236543839 BsKrd 971941 mitsubisi L300 PU ‘2010 disel hitam %081235180802 keramean r2 rw 7 candi sda 971997 JUAL L300 PU’2008 Power Stering 100Jt; Puncak Sambi Sari 27 Sby 972968 MINICUP’83 Mesin Oke Siap Luar Kota 8,5Jt Jl.Nginden IV/35 %70825087 972981 MITSL300PUBakRata‘2001SangatBagus Siap Pakai Tgn1 Dari Baru%40076518 972421 MINICUP’81 bgs terawat msn ok 9jt nego jl.Blimbing 2/23 Pci %085730905223 972878 KUDASUPEREXCEED’2000MERAH Juwingan 44 %70507273-71737573 972717 KUDA SUPER Exceed Dsl’01 Silver AcDbl Bgs Terawat Pribadi%08123003033 BsKrd 972370 T120 SS ‘2002 Troper Karoseri New Arm- adaPutih Pjk Baru 45jtNg TpVr%72995683 972901 GRANDIS’00 (Silver)Pjk-Baru Istw,Dk.Ku- pang Tmr VI/54(Netral Parkir)Buktikan 972470 COLTT120PickUp’78MesinEnakBodyUtuh KIR/No.Hidup Hrg:20Jt%031-70084186 972477 MITS.LANCER’82AcDgnT/Vr/P.WindowMe rahPlat-BBodyKaleng15Jt%03170222711 972703 L300 PICK UP Diesel’96 Siap Pakai Hrg.61Jt Hub:081.553.481.773 972503 MITSUBHISI L300 Full Box’2000 Solar(L) 65JtNg; Kutisari 7/32 %081231118341 972494 L300 stw ‘06+’04 ac central dharmahusa- da indah timur I/M76 %0818 3007 55 972770 MITS L300 PU Diesel Surat2 Lengkap MesinBody Betul2 S.Pakai 41Jt %72931722 972449 NISSAN LIVINAXV1.5ATPjkBr’07KM80RbTgnITT/ Krd;RyMstripKdrs14%7664215/70120653 971685 TERANO GRAND Road XTR’02 TgnI Bs TT/ Krd;Ry Mastrip Kedrs14%7664215/ 70120 653 971686 DJLNISSANSERENA’06NopolS(Bjn)145JtNg Siap Pakai H%81264154/081357956604 972006 XTRAIL XT A/T ‘04 Abu2 Met Istw Siap Pakai Jual Cpt 132JtNego %087852212111 972070 NISSANSERENAHWS’10Grey,AutoSliding, TV Set,Plat-D Hrg:237Jt%085735 376050 972056 X-TRAIL ST’05 SLVR TG 1 IST.TV/DVD LOW KM.CPT BU.SIMOLGT 13/79%085234477778 972143 TERANO SPIRIT’2001 BiruMetalik Cat Ori Mesin Halus Siap Pakai%087756012001 972833 NISSAN LATIO A/T’07 Htm Kond Spt- Baru STNK Baru Tgn1 DrBaru Km60rb % 70603525 972435 GRAND LIVINA 1.5 XV’07 M/T Spt Baru Full Ors Hub:085735477734 972732 GRAND LIVINA 1.5 XV’2008 Tgn1 Pajak Baru 132,5JtNg %78119291/081230152553 972484 GRANDLIVINA1.5’2007FulVar125Jt+Sol- una’2002 53Jt Jl.Sidotopo Wetan 20-A 972459 MARCH’11 Putih (Gres) M/T Km.15Rb Pjk Br Vkool,Jok Klt 129JtNg%081937800100 972436 OPEL BLAZER LT’96 Jok Kulit Ac/Tp/Vr/Br/Pw/Ps Normal 49Jt,Nginden IV/31%72009405 972853 PEUGEOT PEUGEOT ‘93 405 SRI AC/TP/VR Putih Orig- inal 23Jt Nego. %33374146 / 34372030 971453 Peugeot206AT’02MerahOriBdMlsGakPer- lu Ngrawat75jt %71030557/081330685203 972101 PEUGEOT 307’02 Manual biruMet AC/ TP /VR/Audio Jok MBtech.0816524 941/ 70793202 971817 PEUGEOT 405 SR’90 Hijau AC.TP.VR 23Jt PEUGEOT 505 GR’88 Silvr 19Jt%71917662 972203 *PEUGEOT505GR’85MesinEnakMurah* Hubungi : 087854378660 (No SMS) . 972176 SUZUKI PU DP 13jt Ready ErtigaSplash PalingMu- rah DiscBsr031-31415400/083831689488 968764 PROMO ERTIGA,SWIFT,APV,PU,Splas,G.Vi- tara DP/Ang Rgn Krd s/d 6th BsTT Pasti ACC R.Stock%031-71134115-081703911488 969074 PROMO ERTIGA Dp61jtan @2.4jt PickUp Dp14jtan @2.2jt %72794447 /0812312 84343 970641 GEBYAR PROMO LEBARAN R.Stok SPLASH,ERTIGA,APV,Dptkan Hrg Paling Murah+Bns Variasi%031-71651131 /081 330 621680 971064 REALVAN DRV ‘02/10 KARIMUN’05/10 Istw Bagus Pool DP.20jt %031-31282288 BU 971375 BU! KATANA GX’98 Silver Surat Baru.Ry Simogunung Hercules 3/9. %03172065157 971383 BU! KATANA GX’98 Silver Surat Baru.Ry Simogunung Hercules 3/9. %03172065157 971378 CARRY PU’85 PjkBaru Barang Ready 19jt. Tengglis Mjoyo Gg.Botoputi 5%72348554 971394 KARIMUN GX’2004(83Jt) +Futura Real van’2009(75Jt) Kenjeran 207 %08175 102 651 971459 ESTEEM 1.3’91 Hijau Muda Ac/Cd/Vr/Pw/Cl An.Sendiri(L) 41JtNego%031-92053322 971473 FUTURA PU 1.5 Th’05 Jual Cepat BU TAS3 J10/15 Wonoayu%70871119-081234 225789 971611 ESCUDO’05 Htm (L) Ors Mulus Sgt Bagus Bs TT/Krdt Hub:72447948/081615438382 971568 JUAL SUZUKI CARRY PV 1000 Tahun 2004 AC/Tape Hub. 08563087202,085230269814 971632 CARRY1.0 PV’02 AcTpVr SrtBr OrsCat 49Jt BsTT/Krd,Brtng Binngun8/34%71990374 971680 APV’2010 Pjk Baru FREE AllRisk 1Th BsTT/ Krd;RyMstripKdrs14%7664215/70120653 971688 FUTURA 1.3 ‘96 VRC/TP/AC DBL BAN BARU HIJAU AN SENDIRI%08123094446- 71695950 971725 ESTEEM’91 Mls BodiCat Msn Bgs Int ORS 40jtNG S.Pakai BU CptDpt%081331022043 971985 FUTURA REALVAN ‘97 AC Dbl TpVr Bagus 41jt Ng%031-77508133 Taman Timur Rt.19 971776 CARY STW’86 Bd Extra Lmpu Kotak Abu2 Met 16jt Bs Cicil H:71275735 78424695 971924 KATANA 1994 GX Biru 45jt Jl.Simo Gunung Baru Jaya Blok E-3 T:031-77344594 971775 APV X Th’2006 Burgandy (W-Sda) Hub:72589769 /08123154711 971802 KATANA’95 TGN1 Istw BodiKaleng 48jtNe- go RktMngl Jl.Ky.Satari 4/47 %71317865 971794 KATANA’92(L)PajakPjngMulusDlmOriAcT- pVr 41jtNg%031-71909425-08123294015 971928 SUZUKI AERIO ‘03 L Audio TV DVD Ban Baru Terawat %31013646 972050 CARRY PU 1.0’98 PAJAK+KIR Hidup Brg Bagus 37jtNego%03171474790-08133287 9962 972073 FUTURA1.5FULLBOX’06Hitam(W)istmw Jrg Pake Pjk-Kir Hdp 88275320-70172521 971852 REAL VAN 1.3 ‘96 AC DBL/VR (L) Bagus Jl.Abdul Karim 40 Dpn Polsek Rungkut . 971886 ESTEEM’93 1.6Cc (L)Putih istw Pjk Pjg Bgs 46Jt Pondok Wiguna no 6 %77610749 972055 *CARETA’97AC/TP/VRORISINILCATHijau metalik.JL.Semarang 57B%087751127819 971869 BU KARIMUN’02 MERAH (N)L-D Istw Ori MulusUtuh PjkBaru 76Ng%031-75159909 SDA 971803 CARRY 1000 Bd Artomoro Tropeer’90 AC+Vr(L)Bgs Tgn1,Baratajaya 7/25%7100 5365 972064 BALENO’99 Hijau Mtl Siap Pakai Pacar Kel- ing I/115-A%71765074-081234837367 972105 Carry Extra ‘88 Jumbo hijau met has beck (L) h23jt Hub: 03177563624 sda . 971837 ESCUDO TH’2000 Nomade Full Audio Hijau(L)Istimewa%031-70486748/0819 38616804 971870 KATANA’94 Akhir VrPsAc Audio Body Ok Hrg:50Jt Hub:031-72030002/081553481773 971902 CARRY Podojoyo ‘95 Troper AC TP VR Siap Pakai Jl.Tidar 161 Sby %7064 2267 971970 CARRY PU 1.0 ‘05 Jl.Sentana Gg 2/22 Tebel Pos Gdn Sda %08782700022/71970009 971917 CARRY Pick Up 1.0 ‘2004 Hitam Brg Bagus 49Jt Nego Hub:7012 1533 971990 FUTURA 1.3 ‘96 VRC/TP/AcDbl/Ban Baru HijauAn.Sendiri%08123094446/71695950 972134 J.BALENO ‘01 TgnI (L) Hijau Mtl,PW,VR,Ac Dingin,Siap Utk Lebaran%0818374649 972158 CARRETA th ‘96 Silver Vrc/Tp Surat Baru. S-Lamongan.39Jt Nego. 03178090393. 972220 JUAL BALENO’2000 Edis Millenium Warna Hijau Pjk.Des’13 Hub.087834886401 972126 CARRYPUth‘85 bak bodes ori 16jtNg%72550415 972597 KATANA‘90=36jtAcRtVrperumahanBumi Cabean Asri E4/1 SDA %085257270282 972250 CARRYPick-Up‘85L-SbyPajakkirbarubrg bgs siapPakai 17jt %34711544 Sda 972271 REALVAN’97 SILVER AcTpVr BdMesin OK S.Pakai Sukodono%031-72468829/ 7123 7350 972721 CARETA ‘99 AC TP Hitam Wildop 48jt Nego Simorejosari B Gang.7/20A %72736216 972682 SUZUKI READY ERTIGA 42jt,SPLASH 26jt,PU 12jt Bonus+Disc Bs TT %031-8307 0053 972279 JUAL FUTURA’2004 STATION Warna Pu- tih (Nopol L) Hub: 081330041112 972417 SWIFT ‘07 Merah GL Built-Up STNK Panjg 129Jt Nego Hub:%70348755 Khusus User 972262 KARIMUN GX’04 Pmk Cepat Hub:%031- 70636535 Jl.Tanah Merah 2/20 Kenjeran 972398 FUTURA 1.5 GRV th 01 Silver, Ac Dobel (L) Terawat Bs Krdt. Hub:081233994445 972917 FUTURAPU1,5’02TGN1(L)46jt.PRMMARS J20,Psr Mnganti:71695244/085732796914 972982 BALENO’97 Audio/Tv/CD Cat Interior Orsnil 65Jt BsKrd,Nginden IV/31%72009405 972985 CARRY’93 Podojoyo Tropeer+ZEBRA’91 Tropeer Hub:%031-70565693 / 081232361100 972929 DIJUAL CEPAT BU BALENO Th’02 Silver AT Hub:082 332 880 001/031-70847123 972637 DIJUALSWIFTSTTh’2008WarnaBurgundi Hub:3762588/081 6517 094 972699 KATANA’90 Blitz Putih AC/TP/Ori Luar Dalam Harga Nego (L-Sby) %031-72648464 972647 CARRY ‘91 Adiputro Tape/VR/Ban Pajak Baru Siap Pakai Hub:%031-81299837 972351 BALENO 98 HijauMet Bgs65JtNg PdkWage- IndII/ii-11%70989530/081330637200 Aloha 972852 BALENO’98 Ors Cat Total Hijau Mtl Luar Dlm Ors Tgn ke 2 Hub:%72446464 972872 Cary 1,0 PU94.Cary Boxantikarya 95.Cary Artomoro91.31Jt.Mob2 Istw.%92347907 972926 KATANA’94 ISTW, PS,AC Dingin,Siap Pakai. Hub.%71713964/081330464331 972971 ******BALENO TH’2000AC/TP/VRSilver gold 73jt Hub:03170678289/081703150055 972712 FORSA’87PUTIHAC/TP/WD 33,5JT HUB: %031-71096877 972939 CARRYPodojoyo‘98 biru kondisi baik %77523390 sda 972746 KATANA ‘92 +CARRY ‘89 AdiPutro W-SDA Hub:031-83051151 /77120622 972788 KATANA GX’96 (L)PJK BARU AC VR AU- DIO BIRU OrsCAT ISTW%72078397-08121 6657114 972854 LIHAT HAL. 20 SURABAYA MOBIL DIJUAL DAIHATSU PROMO DAIHATSU . . . . . . . . . . . . . . .1X25 . . . . . . . . . 968357 DAIHATSU LEBARAN . . . . . . . . . . . . .1X25 . . . . . .. . . .. . . 970015 PROMO DAIHATSU JATIM . . .. . . . . . . .. . . .1X25 971703 NISSAN NISSAN BIG PROMO . . . . . . . . . . . . . . .1X25 . . . . . . . . . . 971012 SUZUKI SUZUKI LEBARAN . . . . . . . . . . . . . . . . 1X25 . . . . . . . . . . 970014 PROMO AKBAR SUZUKI . . . . . .. . . . . . . . .. 1X25 971719 MOBIL LAIN-LAIN KREDIT MOBIL . . . . . . . . . .. . . . . . . . 1X25 970025 TUBAN DAIHATSU SAHABAT . . . . . . . . . . . . . . . .. 1X25 971709 19 DAPATKAN Mobil Baru, Berkwalitas + Garansi HARGA KHUSUS pembukaan showroom A.Yani dan Jemursari Sempatkan dan terbatas BISA BAWA PULANG MOBIL BARU HANYA DENGAN 5 Rp JT
  • 22. SABTU, 29 JUNI 201320 SUZUKI ESTEEM Th’96 Pajak Baru VR/PS/PW/AC Miror Jalan (L) Istimewa 53jt %71057165 972752 CARRY Th’84 (M) Body Handayani 14jt Hub:88296634/0823 3290 7671 Sda 972768 SUZUKICARRYTH’91Ac/TpIndonesiaJaya 27JtNg %77576721-081357756577 Waru 972733 CARRY’87(L)Station Merah BodyKaleng Dlm Orisinil Mesin Dijamin Bgs%88151513 972955 KATANA’88 4x4 Hitam Modif OffRoad Sgt Istw Luar/Dlm OriFresh%0856 320 2033 972769 Djual Careta Th 2000 Tgn 1 Istimewa Luar Dalam Hub %03183715957 972395 CARRYPODOJOYOTROPER‘96BiruMetPa- jak Baru AC TP Vr 40jt Nego%7739 6075 972861 NEW ERTIGA Splash APV Arena Swift SX4 Pick Up Proses Cepat Bisa TTLuar Kota%031-70127650/082140973335 972490 CARRY PickUp 85=14 Carry Pu 94=32Jt- Zebra Pu 90=16,5Jt%77744309/0821329 88519 972963 JLCPTCARRY10PU‘2004HitamIstimewa An.Sendiri Jl.Pakis 8 %71238259 972549 TOYOTA VIOS 03’Ahir G Tangan Pertama W(Sdj) %%08885284414/03191992992 Kond. Istimewa 969150 INNOVA V, Coklat Met, Mls, Tgn Prtm, Ori. Hubungi:0318499970, 03171885880 . 970155 Camry Silver Th’2003 Manual Tidak Mengecewakan Telp %0813480 98810/ 71727318 971002 KIJANG PickUP BOX’86 Ori CasisUtuh Cck Jualan Serbaguna BuktikanJl.PradaKaliKen- dal 249 Hr.Muhammad%081703235533 971350 KIJANG KRISTA Diesel Manual’2001 Akhir Hitam L-SBY Istw BisaKredit%72341737 971357 AVANZA G TH’08 Hitam Hrg 128jt Hub: Ci- manuk 28 Gresik. 081332600669 . 971389 SOLUNA ‘00 GLi Coklat: jl.Menganti Desa Setro RT14/RW7 Gresik. 085851222265 971392 CORONA’91 Ex Salon Ps/Pw Putih H:Ngin- den V/5A %70105011 971429 Limo(vios’04)Ex Blue Bird Silver. brs2: 68Jt.BU:%08883256464/085731784992 971591 KIJANG SUPER ‘88 Nusa Long Istimewa 38,5Jt Jl.Ry Lontar 119 Sby 08165429153 971476 KIJANG’88 1500cc Htm Mulus Hub;Gub. Kertajaya 7C/3%081585311092/0813322 55500 971523 AVANZAG’08SlvTg1(L)SptBr125JtLGX’01 Dsl Turbo AT Htm KrdSIMAS%92122112 971477 KJG GRND EXTRA’95 AcDbl/Pw TT/Krd TT/ Krd;Ry Mastrip Kdrs14%7664215/70120653 971687 VIOS G’03 TgnI(BUKAN Mantan TAXI)BsTT/ Krd;Ry MastripKdrs14%7664215/70120653 971692 AVANZAEVVTi’09HITAM116JT Hub:Deltasari %31225637/8552960 971753 SOLUNA GLi’00BukanTaxiBrgIstwOriL/D 70jt %081330789770 / 03172633799 971750 INNOVAG’05Htm140jtDp38jtagsr3.980rb X35 Sepakbola A/17 sda%085230106029 971947 AVANZA E ‘2006 Silver AC TP Vr Kondisi Betul2 Bagus 107jt Ng%0821 3282 1888 971730 KIJANG INNOVA Th’2005 Tipe V Warna Merah Hub:%031-72434299 971952 TYT TWINCAM 1600cc Th’89 Abu2 TuaMet- alik 51Jt Istmw(L)%71635233-08133296 4130 971968 Kijang Krista’02(Diesel)Silver Original Mls ACDgn Msh Asli 122,5jt%72724410 972032 STARLET BAKPO 1.3 ‘93 AC TP VR Siap Pakai Pondok jati Q-28 SDA%031-91700272 971967 KIJANG SPR G Short’95 64JtNg AC.TP. PS.VR14 Kdsi Oke, Residen Sudirman 68L% 31416341 972065 KIJANG LGX ‘2001 Dsl Manual Biru Metalik AcDbl 115Jt, Krtjya II/50A%5018572 972068 KJG SUPER’90(6 SPEED)AC Dgn/VR/CL Pjk Pnjg Ban Bagus 39,5 Nego%081331480012 972052 KJG LSX th’00 AcDblPsPwEm3TvVr,KJG LX’97 AcPsClVr OriSmua.KrdtOk. %88286 555 971816 VIOS’04G PsPwEmspAudTv,GCOROLA95 AudTvVr18Ori SOLUNA’02 AudTv52Jt % 88286 555 971820 KIJANG NUSA LONG th’90 AcRtVr43Jt,KJG Super87 AcDblRtVr38Jt.KrdtOk 88286555 971828 KRISTA Dsel 2000 (L)Biru Silver An.Sndri Trwt Pjk Baru 112Jt NG%03170261496 971836 **SOLUNAth’00GliSANGATISTIMEWA** Bukan Ex Taxi.AcTpVr R16%03183330003 971841 KIJANG SUPER G’96 PMK LONG Pajak baru body klg (N-MLG KOTA)%72314464 Juanda 971844 INNOVA V Bensin’05 Manual Htm KM-Sd- kit Istw (L) PjkBr 081230081867/21018698 971934 *JUAL T.LGX 2003 HITAM METALIK.138jt Nego Hub:031.70637099.Bogangin I/81 BU 971783 TOYOTA TWINCAM th’90 silver ac tp vr istimewa %0812 3065 9095 .waru 971942 HOTPROMOFORTUNERGVNTDsl68jtLsg Bw Plg FreeSparepartService%70994999 971797 SOLUNA XLi’00 Ors Cat Ttl LrDlm Km75Rb Istw Skali 71Jt Bu Cpt %031-72022225 972067 CORONA TT’81Ac/Tp/VrMesinBagusBody Mulus 17,5Jt Hub:%031-71952969 Spj 972106 COROLLA’75 (N) Merah/Ac/Tp/Tv/R.Cing Antik Hub: %031-71253917 972109 SOLUNA’03exTaxiBluebirdPW/TVBiruMet Mls 60jt Ng.BSI B2/35%081357003062 971909 GRAND EXTRA 1.8 Long’95 HijauMet STNK BrBgs Jl.Pangiling 318 III%0811330734 972096 KIJANG PICK UP’94 Biru Bagus Siap Pakai(48Jt) Hub:081217670027 971838 INOVA V Bsn AT Des’04 BiruMet Istw Mlk AnSdri081703398791 PuriLidahKulon K2 971926 CORONA TT’81 AntikFul Orsinil Gu- nungsariIndah AB-33%0888 573 4648- 71148566 972031 BLACK YARIS AUTOMATIC’08STypeSpe- cial-Bagus-Milik Sendiri H:031-91369675 971944 KIJANG LGX ‘2000 Silver 1.8 (L)TGN1 San- gat istimewa 107,5jt Ng %838 98988 971986 AVANZA E’04 mdel G (L)Biru ORS PS, PW,VR,FoglampSpion Lighting 98jt% 70636 378 972924 KIJANG‘88PUSemiBox Gub Kertajaya 4D/61U %81911127 972171 AVANZA E ‘06 (L) Hitam ORS PS,PW,VR FULL VAR 105jt istimewa. %03191515156 . 972410 KIJANGLSX‘2002(L)SolarIstwOrsCatFul- var Bratang Binangun 9/20%5041454 972724 K.GRAND Extra’95 1.8 Merah(W)A/n Sdr 70Jt Nego Hub:%79560354 972375 AVANZA G’06 VVTi (L)Tg1 Slver ORSCAT 118jt Medokan Asri Utr 7/15. %70686811 972740 AVANZA G th.2005 (N-Malang) Gold Pajak Baru 107Jt. Hubungi:081615186543 . 972451 KIJANGSX1.8th‘02Tgn1HijauMet(L)Ac/ Tp/Ps/CL Ban baru.78Jt.%70336956 972464 KIJANGLONG’91AC/TP/VR42jtng.Ry.kundi 38A(Tmr psr wdung)71697325 KREDIT OK 972952 KRISTA TH’2000 Diesel (L) AC DOBEL,PS, PW,VR 103jt istimewa.Hub: 0818394452 972718 KIJANG SUPER’92 AcDbl/Tp/Vr/Br Cat Msn Bagus 41Jt,Nginden IV/31%72009405 972979 KJG SPR’91 AC dbl/PW/RT/VR/BAN BR/pjk pjg 41jt ng.perum alam pesona I blok O-16 ds Sidorejo Krian%81229469/081915235999 972466 JUALCOROLLATWINCAM’91GT1AE92Abu2 Mtl Mulus Hub:0852.3007.9300/8057399 972578 KIJANG LSX Diesel’04 MblBgs J.Cpt 118jt PjkBr.KingSafira A6/15 Sda%78400078 972694 J.CPT TWIMCAM’89 1300cc AC/CD USB(W- Sda)Pth Mutiara Ist Cat Br%081230630628 972794 KJNG SUPER’88 AC Msn SIP 38Jt Nego (W- Sda) Bluru Permai FO/21 %081803055750 972838 KIJANGPU’93IstimewaAC H:Jolotundo Baru 3/1 %70160074 972836 AVANZA G’2005 TgnI Hitam Orsinil Jl.Pucang Anom V/49 %71087660 972891 KIJANGKRISTADiesel’2001 Jl.Pucang Anom V/47 %70458447 972899 KIJANGSUPER’1989(L)KREM 41JT AC TP VR %5616006/7886500 972907 DIJUAL KIJANG’93 BU JL.Anggrek 27 Wag- eTaman Sidoarjo 972927 Avanza G’06 Htm=123.5 +07.G Silvr=125 +08 akir G Silv=128.5beji%081232328113 972740 Innova G’2005 bensin kuning silver meta- lik orsinil ( L ) hub.0815 5531 6500 972754 LGX ‘2001 Biru Tua (L-Sby) Solar Manual Pajak 4/2014 %081330754898 972805 KIJANG PU ‘84 Istimewa +Carry PU’87 Istmw Rm Zona Alam %0857 0700 0779 972859 VIOS’05 L AC/PW/PS/CL/Alrm S.Mundur/TV Htm Met 85jtNg%91900044/081330577 827 972765 KIJANGKOTAK’82STWInteriorOriAcTgn- 3 Asli-L Hub:087851442110 972673 ********INNOVATH’2007GREY****** Bagus Istimewa Hub:085.722.650.999 . 972719 KIJANG SUPER’87 6Sped DblBlwr RtVr S-Mjkt Abu2 37.5Ng%71533112/08214287 0777 972825 TOYOTA Twincam ‘88 AcTpVr Mbl Istw %031-83200447 /7664156 Kedurus IV- duren/5 972892 **** KIJANG LGX TH’2004 SILVER 2.4D **** Super orisinil Hub:082.131.650.999 972686 TOYOTA AVANZA Merah’2004 Type G Hub:08123261227 Kebonsari 7-B No.10 Sby 972498 KIJANG ‘91 NusaLong 6Speed AcTpVr Istw 47Ng RktMngl Ky satari 4/47%71317865 972923 KIJANG SSX ‘99 Bsn 1.8 AC.VR.PS Istw 80jt Pket Krd 3Th,Dwangsa 124%71256262 972462 TIMOR JUAL TIMUR DOHC ‘97 Super Istimewa Hi- jau Pondokjati AJ-12A SDA%085732989922 971751 TIMOR th ‘00 SOHC Fullvar Ori Luar/Dlm Asli Hitam 47Jt NG.%77328460 BU CPT! 972480 VOLVO Volvo960 Royal Mdl S90 ‘96 Hitam PjkBr Tgn2 An.Sdri(L)Trwt.50Jt NG%31268728 972723 MOBIL LAIN-LAIN KREDIT MOBIL BEKAS BS CARI SENDIRI. Hub: %71195447/081333008287/081654 36792 971390 GEELY MK GS 1.5 Sedan Th’2011 Tgn1 BU Hub:031-91911012/081357477880 971843 JEEP CHEROKE’98 AT Lmtd Airbag FullOrs(L) TAFT HUNTER’83 Antik OffRoad%92122112 971482 HILINELONG91BdKlg,AC/Ps/4x2Trooper Highroof 94,CatInt Ori 085255090707 971978 TRUCK DELTA ENGKEL (4RD) ‘97 Biru Cat Ors.Ta- man Pinang N-3/3 Sda %0812 3114 1909 971544 ISUZU BISON ENGKEL th ‘93 Kond Bagus Siap Pakai 39Jt NG. Hub: 081216535569. 972156 DJLDUMPTruckTh’2012Dyna130HT+ELF th’2012 NKR 71 HD.Hub:0812 3130 8990 972810 MOBIL DICARI CARI MOBIL Sgl Kondisi,MerkThn Berani Hrg Tinggi%031-71491443/081231330234 971739 VARIASI/SALON MOBIL PIONEER SONY Alpine Kenwood TV/DVD HID Xenon Audio 1,5jt Accoustic%77061225 972327 LAMPU MOBIL ANDA Kuning/Kusam Kami Solusinya %0813 3330 2172 -0838 9951 972 972269 BENGKEL/SERVIS MOBIL ALAT CLEANING+Pulse Injektor,Coil+ Ig- niter Tester BS MBL/MTR 2jt%03181000119 970140 MOBIL DISEWAKAN 100RbMURAHKjg,APV,Xna,Lxio+Spr,JlTiket n Tour24Jam HALIM%5013744/70102636 968605 **DISEWAKAN AVANZA ‘2013** +DRIV- ER Paling Murah Hub:0857 5516 2847 969257 Sewa Mobil Apv Avanza 100 Rb bs luar kota/juanda. Hub:083856246082-71498718 971384 Mj 70777306/081331012970 Neys Cmry Alts Elf Prgio Avz inovLGX BusACpar25-60 971724 Sewa Mobil + Driver Avanza/Xenia D/L Kota. A/J Juanda %031-5453169/70235999 971875 MOTOR DIJUAL HONDA JUALCPTGRAND’97W-Sidoarjo Hub: 081553906166 971348 KreditmotorHONDAbaru,cashback1,7juta, promo akhir bulan trbtasT:77556797 971471 HONDA BEAT ‘2010 Putih (L) Mulus Tgn1 11jtNego Hub:031-8712594-081330343463 971537 GL Max’03 +Supra X 125 Th’07 + Jupiter’04 OrenRungkut Lor 5/30 Hub:88080928 971573 FIT07=44Leg02=3Shgn99=28Smas04=37 Mocin02=15 Veg05=42 Veg06=52 %71103 636 971847 Lgnda03 Pro94 Max91 CB100’86 S.Cup82 RGR95 Bravo96 Sigma97 Krh4/54% 70908 555 971856 SUPRA X 01+SUPRA FIT’05ORS Tk.Pancing (Tmr POLSEK SDATI)081330586657 /7169 6056 971906 Honda Blade Repsol. Th 2012. ( 12jt ) Pan- tai Mentari J/4. hub: 70131550 . 971876 Dijual Scoopy ‘10 Warna Ping Rp9,5Nego Hub:%03170174545 Bumiarjo 3/15 972080 SUPRA X’02 @4,6 GREND’96 @2,5 VEGA R’04 @4,9 - Ngagel Tirto 2/25 %71898663 972131 SUPRA FIT ‘2004 Harga 2.5jt Hub:Pakis Tirtosari Gang.19 No.16 972280 Tiger 94,98,01,02.03.04(N)’05 MgPro04; 7,4 +06;85 Gran97;33 Prima90%7256 3030 972672 MINERVA 2010 + MEGA PRO NEW 2011 Hub Rungkut Tengah 3B/26 Telp;77461660 . 972705 TIGER ‘2007 Hitam Jarang Pakai Nego Jl.Sampurna 57 %08123161219-91199988 972270 Honda Tiger Th’99 L kond bagus,pajak baru,Rungkut Menanggal H:085706200020 972767 Supra125TD‘07WarnaKuningHrg.7,2JtNG Karang Empat 9/79a %083856322173 972934 FIT X ‘2008 (Gresik) Vega ‘03 Grend ‘96 REVO’09 nego %71605952 /08123155487 972912 Scopy’11 (L) 10,3Jt/BEAT’11 (L)11,2Jt/Mio Sporty’11 9,2Jt Hub:085232771106 972807 SUZUKI Sogun00=32 Tosa04=23 Legenda03=38 Grand92=27 Alfa96=18 Astrea85=21% 72430667 971345 Shogun 96 26 Crystal 94 15 Grand 93 26 Shogun 02 BPKB ilang 2jt %70671287 971981 VESPA PIAGIO 150 Liberty’2013AkhirMaticHtm Mls Jrg Pakai %08165419014-72103557 971437 YAMAHA VegaNew08=8,6FitX08=6KarismaX05=6 Kirana05=5,3 TggilisKauman1/12 71125943 971896 YAMAHA VINO. Th 2012. Putih ( 11.5jt ) Pantai Mentari J/4. Hub: 70131550 . 971878 JUPITER Z CW’09 Htm Mrh a/n Sdr 11,5Ng Indrapura gg Masjid 16 %083831888022 971881 JUAL MIO’11 8,8Jt - MIO’09 8,2Jt CW Pajak Baru Sroko 1 %081335118696 972264 MIO’08 2 Unit STNK Bru 7,1+CW 7,3 Sono Indah I/51(Darmo Grand)%031-77185242 972293 MOCHIN Djl GEROBAK TRISEDA Th2012 BGS,S. Pakai a/nSndr.TOKO TAMYIS Raya Tenggilis 129. 971808 MOTOR DICARI DICARI SEGALA MERK SEPEDA MOTOR. HARGA O.K.E. Hubungi: (031) 72009479 . 971170 ANDA JUAL SEPEDA MOTOR? Jl.Gembong Sawah Barat 63 Sby %70526617/3715147 971405 SIFA MTOR terima sepeda mtor segala mer- ek T%031.78627106/087852608291 971566 DICARIMOTORSEGALAMERKBeraniHarga Tinggi Hub:031-70800332 971501 MALANG MOBIL DIJUAL BMW BMW 730 iL 1996 VR19 OEM Audio SQ Nor- mal Cruize Ctrl %082 3355 71 999 970956 DAIHATSU TERIOS TX Adv 2011 Hitam Km 7000 Is- timewa Hrg Nego%03419734208/081233 160618 970781 DIJUAL ESPASS’95 1300 Silver Bagus Hrg Nego Hub:08885556366 970782 DIJUAL XENIA Th2010 di Komp.Pln 102 Krglo%083834176766/081319406581/23 53156 970815 XENIAAngsuran1,8JtanUangMukaTeri- os 20Jtan Xenia 19Jtan%(0341)2384414 970968 WINNNER 1.3 TH91 IstwKmplt AC/ VR16/PW 41Jt:RyJantiBrt7%4433911/081 945551422 970983 ESPASS ZL’05 Ac/Tape Istmw 59jt/Espass Pu’02 Ac/Tape 40jt Bu %087859145204 971007 ESPASS’96 Mrh N-kota Pjk Br AC Dbl Dgln Ori Total L/D Msn Sip %0341-8123753 971046 TARUNA FGX 2004 Biru Silver Pajak Baru N Kota Cat Ori %0888 588 0500 971051 HIJET 1000 TH84 (N-KAB) 21JtNg + GAL- LANT ZIGMA 79 (N) ORI 30Jt %744 3637 971147 XENIA XiFam10 121/2.5Jt INOVA G05 148/3.8 Maestro90 43Jt%081235008659 BsSMS 971196 TARUNA FGZ’02SilverMetOrsSgtIstPjkBr Rec.Astra 105jt %081333751380 971292 XENIA Li’09MerahMaron32rbKmVelgRac- ing Tgn1 (N) 108jt %085234539041 971294 ZEBRA TROPER’91 Biru(N-Kb)Pajak Baru Body+Msin Bagus 25Jt Nego%081 33583 8787 971370 XENIA Xi 13 Vvti Htm’06/Granmax Pu’09 13 Mrh Nego Hub:6616686/082143623457 971379 NEW XENIA X + Dp 23Jt/Pake Angs 2.051.600 Aja %08125251667/8178872 971413 XENIA Li VVTi 09 (L) Bayar 19Jt Angs.2,6x 47 IritMulus Terawat%0341-7779928 971462 XENIA2005XI(1.3)SilverOrsCat(B)97JtNg %0343-7663363 Bangil 972009 TARUNA CX’02 N-Kota Merah Metalik AC/ PW Hrg 97,5jt Nego++ Hub: 0341-7580513 971821 ESPASS PU 2006 Putih Full Ori %081 334 867 037 / 0341 - 2888837 971785 ZEBRA BODYTECH’91 Abu2 N Cat Br Msn Enak Pjk Pnjg 25jt Ng %7712529/9511188 971800 EXTRA PROMO XENIA DP 20Jt,GMax BM DP15Jt,Terios 20Jt ProsesCpt%0341- 9572750 972016 ZEBRA BODYTECH’95 Sliding Mulus Biru AcDobel L-Sby Siap Pakai 35jt %7742558 972124 HIJET 1000 Th83 Silver Siap Pakai 13,5Jt Nego %(0341)2824 818 972382 XENIA Li Deluxe Plus’09 Akhir Silver;Great Corolla’93 %9515006/082332923597 972290 TARUNA FL 04 Silver ORS ISTW 92 JT Hub: 7729467 SINGOSARI BU . 972492 TARUNA CSX PMK 2001 Biru Silver Dan Sidekick Drag One Pmk 1998 %0816555799 972371 TAFT GT 88 Plat(N) Biru AC,TP,VR Ban31 CL/PW/PS SuratBaru 58Jt 0341-7376254 972632 PROMO DAIHATSU GMax DP8Jtan XENIA DP19Jtan READY STOCK%081233060025/ 7033544 972576 ESPASS 1300 TH97 Merah Maroon MULUS VR/Tape (Mlg) 39Jt Hub % 972525 FORD FORDRANGERXLTDblCabinPW,PS,EM,Air- bag VR22 Asli-N Tgn1 Istw%082335571999 970960 TELSTAR TX5 Doors Chalence Hatchbac’95 Slvr Audio AC,VR17 Nego%081230942112 971047 FORD LASER’92(n)Biru AC/TP Brg Bgs Siap Pakai 25Jt Ng %7001857/081235609157 971319 HONDA JAZZ RS Mt Pmk’11 Jan Abu2 Spoiler HidX- enon L Tgn1 195jt Istmw%085646776069 970788 JAZZ’08 IDSi Biru Metalik Tgn 2 (N) Pajak Baru Full Audio % 729 4402 970881 NEWACCORDVTILAT2000SilverIstw95Jt: RyJantiBarat7%4433911/081945551422 970977 CIVIC NOVA SPORT90 Istw Kmplit VR17 AudioTV PW/PS 58Jt%4433911/0819455 51422 970981 OPER KREDIT JAZZ 04 Hrg 75Jt Kurang 17x3Jt FullAudio%8666579 / 085203720 125 971156 CIELO VTEC 96 BiruTosca(N) Bagus Ori BBS R18 SiapPakai Nego%082 334 951 166 971159 HONDA GENIO “95 Warna Hijau Istimewa AC Dingin Hrg 76JtNego%085 231 688 101 971169 JAZZ RS 2010 Bln 2 Grey Manual Brg Mulus Istmw (L) H:SAIHUL%081 334 993 993 971564 JUALCIELOVTEC96HitamVarVR18/TAPE/ DVD Mulus Siap Pakai.Pemakai%7773955 971561 GENIOTH94Abu2TuaMet(N) ISTIMEWA PajakBaru%0341-9501195 971547 JUAL JAZZ Vtec’06 MT Silver Stone Km 26Rb,Tgn 1 (N) %085.649.559.888 971661 CIVIC WONDER’87 Msn Hls Body MlsKlg Pjk Br Hrg.33,5 %081323933519/7555030 971677 CRV VTECH 04 Mnl Silver PjkPjg SgtTrwt Lsg AnPbli NG%7658808 PinBB 2804d026 972010 HONDA JAZZ Tipe S MATIC 2011Akhir Polis KM15Rb Tgn1 Mulus%0341-774 9355 972620 JAZZ2007VTECM/THitamOrisinil(L)Tgn1 Low KM Hrg Nego Tlp%081252012212 972579 HYUNDAI ATOZ GLZA/T2000(N-kt)GoldMetOrsLuar Dlm Istimewa %(0341) 743 3789 970830 SANTAFE2001ASLI-NTangan-1 VR19 Istw %082 3355 71 999 970958 HYUNDAI ATOZ 2002 At Istw Hitam Ori Lengkap N-Kota Hub:0341-5411277 971651 ATOZ 2002 Hitam N/Camry 24G Mt 2005 Jl.Jakarta 4 %08170477778 J.Salah Satu 972155 ATOZ GLS 2003 Silver (N-MLG) KM Msh 65Rb Harga 74JtNEGO %082 230 926 061 972545 ISUZU PANTHER TOURING’02 Mt Biru W No.Pjg 17 Pjk Tlt 1Th 135 Ng Istw%081334112311 970802 DIJUALPANTHERHI-SPORTY97 (N) %0341-911 9086/081230909945 970972 PANTHER LM SMART 06 Biru Mtlk VR/ PW/EM/DVD/PS/AC 117Jt%0812 3535 886 970971 PANTHERHIGRADE96(L)KomplitIstw72,5 Jt:RyJantiBrt7%4433911/081945551422 970978 PANTHER PPL’95 AC/Original N-Kota 68jt Nego Hub:0341-8800337/081233657787 971045 PANTHER HIGRADE’95 ACdbl VR PS PW RT CL N Fulvar Klg Msn Hls S.Pake%7575527 972408 KIA NEW PICANTO 2009 Merah Full Variasi Tgn1 Istimewa 94jt Hub: 08123329664 971043 OPR KRD KIA RIO 01AT 25JtNg Ang25x AudioTV PW CL Kmplt%7561680/0857 4960 5678 971134 KIA VISTO ZipDrive02 N-Kota Ac/Vr/Cd/Cl Warna Emas 70jt Nego %0341-7054598 971107 CARNIVAL DIESEL Manual 2001 Hitam (N-Mlg) VR17 92Jt Ng%7783556/ 081334 648047 971316 CARNIVAL DSL 01 AT Siap Pakai N-Pajak Pjg 73JtNego %8698998 / 081334377788 972614 MAZDA MAZDA TRENDY Th88 Sangat Bagus 33Jt Nego %0341-2823649/081233683091 971416 MAZDA E2000 Th98 N-Kota Silver Istmw 60jt Nego Hub:5386893/081233264575 971427 MAZDA MR 91 TP/VR/ACDgn Dlm Ori Cat Mls Siap Luar Kota 20JtNg BsTT%996 3072 971553 INTERPLAY97 32,5,G.CIVIC Mtc90(N)39,5 ESTEM1.6’94 48.5%081945777323/7068141 971465 MAZDA INTERPLAY 90 AC/TP/VR Silver Mulus Istimewa 45JtNego%0341-9385 999 972000 MERCEDES DJL MERCY NE E230 “96 Htm ExMblMnten Nm.Sndr Pjk05-14 BgsMls%0878 5997 1131 971204 MERCY BOXER E 300/MT th 91 Pakai 93 Green On Green Istw %0812 1700 7002 972311 MERCYA140ISTIMEWASEKALI UiritPol Normal%082 3355 71 999 972669 MITSUBISHI MITS KUDA Merah Maroon’99 Akhir Super Exeed N(Kt) 87jt Kond.Istw%0818380301 970798 MIT.MAVEN GLS 2007 Istimewa Skl 102Jt: RayaJantiBarat 7%4433911/081945551422 970980 DP MURAH New Pajero,Outlander,Mirage Hub:ROSYAD%081233772758 / 0341-3148 135 971187 MITS.COLT 120SS “93 Biru Met Velg Racing Hrg 32,5JtNg %0856 0442 8906 971164 LANSERSL84 Biru N 25Jt Nego%081944952150 971406 MITS.COLT T120ss 2010 Hitam Hrg 72jt Hub:7777172/081217137000 971496 LANCER EVO III TH93 SOHC N-Kota R18 Istimewa Siap LEBARAN %289 0001 972575 NISSAN NISSAN TERANO SGX 95 Hitam(N) IstSkl 82Jt:RyJantiBrt 7%4433911/081945551422 970976 ALL NEW NISSAN Grand Livina OpenInden VoucherBlanja1Jt/BlnJuni%081234838157 970988 GRAND.LIVINA SV MT 07 Silver Stone Tg1(N-KOTA) PjkPjg Terawat %0341-989 1020 971181 GRND.LIVINA 1.8 Ultimate AT’07 Hitam FullAud Perfect Condition %081334411669 972322 PEUGEOT DJL PEUGEOT 206 Th2001 Matic Hijau Plat- AG Nego Hub:085791059836 971297 206 XR “02 Merah Manual Tgn1 Seperti Baru Orsinil Terawat 72Jt%0341-7779928 972619 RENAULT RANAULT 18TL”86 AC/RT/CL Orsnl Anti- kPenggemar (Asli-N)%7016888/ 08194555 7888 971145 SUZUKI KARIMUN GX ‘2003 Merah Metalik irit Pa- jak Bulan 10 Hub:%0812 3327 739 970966 SZK KATANA GX 98 N Hijau Metalik AC,Tape,PS,VR %0818385503/7032403 971036 BALENO 2000 HIJAU MET(N-KOTA)Bagus Ori Cat Siap Pakai 75Jt Hub%7327 816 971151 EVERY1.3 Silver N 2004 7Seat Ac/Pw/Ps/Cl Airbag Siap P%9319996-085815255331 971108 KATANA GX’99(N-Asli)Tgn1 Hijau Tua Luar+Dlm Msh Original %(0341)7016644 971314 ESCUDOTH94(N)ORISINIL BiruTosca FullVar%0341-9311007 971585 FORSAGLPMK87PutihACVRMP3IstwMsn- Halus 28,5JtNgo%8123753/08125262269 971483 PICKUPCARRY85(N-KOTA) Serius Hub%0341-7788497 971468 KATANAGX95N-KTAC/TP/VR/PSBgs54Jt: GrhLaksanaTdrB1%7300415/08882313457 971457 S.SIDEKICK’95 Istw Biru Ac/Vr/Variasi (N) No-Panjang Hub:081233413229 971758 PROMO MURAH ERTIGA@2,3Jtan NEW SWIFT@2,5Jtn PU DP17Jtn%9568253/0821 41959999 972044 APV Th2007 Hitam Plat N Tgn 2 Harga Nego %0341-9079563 972230 SUZUKI KARIMUN Gx’04 Merah Met Ori L/d Pw Ps Hub:03418446381 972312 APV ARENA 2009 (N) Tgn1 Pajak Baru SIL- VER Bagus Sekali %(0341) 9302 888 972586 FUTURA DRV 02 (L) Pjk Baru Abu2Met AC DinginIstw%088803874496/0341-5433567 972594 BELIMBLBARUSZKDisiniTmpatnySplash/ Ertiga/APV/PU1.5 Ang78Rb/Hr%7300957 972638 FUTURABOXTH2007Orisinil (N-MLG)62JtNEGO%081 615 845 418 972653 CARRY ADIPUTRO 90 Hijau(N) AC/TAPE/ VR/ 4BanBaru 39JtNgo CPT DPT%0341- 7575272 972657 OPR KRDT Baleno Mrh’02 Stnk Baru Dp32jt Ang 2.493x29 Asuransi Hub:9168628 972468 TOYOTA TOYOTA STARLET 89 N Biru Met AC DVD V.Rec Terawat Baik 41Jt %7569750 970882 INOVA DIESEL Matic V 2010 Tgn pertama N asli,Istmwa,235jt. Hub:0341-7638888 970896 KIJANG LSX DSL DressUp 01 N-MLG AcTP VrPW CkltMet JokBkld Klg 102Jt%5432345 970962 AVANZA G VVTI 2006 Hitam Istw Asli-N 124 Jt:RyJantiBrt7%4433911/ 08194555 1422 970982 LGX 2001 PMK Orsinil Luar/Dlm Sgt Bagus (N-Malang) 115Jt Hub%(0341)8100 308 970985 KIJANGKAPSULE1.8’97 Audio,HID Istimewa %9201818 971041 COROLLATWINCAM88LifeBack (N) Biru 37JtNego%081231837783 971162 TOYOTA AVANZA Angs 92Rb/hr Bs Tu- karTmbah SglaMerk%0341-7702442 Pin 2A46 FF3A 971189 TWINCAM 1.6 SE 90 ISTWOri L/D Bd. Full- Kaleng CoklatTuaMet 52,5Jt% 081 7388 280 971186 STARLET’91N-KotaBiruMetAc/Vr/Pw/Au- dio/Cl P.Stering %08123350580 971290 CORONA TT’80(1800cc)Antik Ori Simpanan Pnggemar AC/TP/VR %8100069-Bs TT 971307 GREAT CRLLA94 Abu2 Tua Met(n); Kjang Std 88 Long Hju AC/TP/VR(n)%0838348 33060 971312 J.CPT Starlet’97 (N) Mrh Maroon Istw %7714472/085231565275 971322 KIJANGINNOVAG2008Abu2Met No(B) Istimewa%082 113 972 242 971581 STARLET SEG1.3 “91 AC,Audio.P.String. P WindowBanBr51Jt%7307760/08125278770 971452 AVANZA G’07 VVTi Slvr FulOrs Tg1 125Jt Antik SptBru BsKrd SIMAS%08123072112 971510 KIJANGNUSA1.5LONGOrsACTVVRTH95 Body Kaleng Hub%081 252 00 965 971940 NEW COROLLA 1.8SEG 98(N)CoklatMuda Met Dbl Airbag,ABS Trwt%081.838.5800 971919 INNOVA G DIESEL 2008 Manual HITAM (N) Tgn1 Terawat%(0341) 2200054 972001 AVANZA 07/06 SILVER (N-Tgn1) Pera watan Rutin Di Astra 125Jt%081 233 20 647 971980 NEWINNOVADIESELGM/T2011 Putih Istimewa%081.334.822.677 972008 KIJANG NEW Spr’93 Nusa Short Biru Met N- Kab Audio Ac Dsbr Sdn %081805070773 972128 AVANZAG2009Hitam131Jt (N) Nego %0341-8111494 972378 YARIS E A/t 2010 Silver N-Kota Km Dikit Pa- jak Baru Siap Pakai %03417007772 972179 KJG LONG G 95 Biru N-Kt CatMls Trwt AC TP VR PS Ban90% 67Jt Ng%081334430989 972363 KIJANG LGX 1.8 TH”00 Hijau (N-Asli) Cat OriTotal%081333450333 BB By Request 972539 STARLET90BAKPAO1.3 Hitam (N-Batu) 52JtNG H%8382626 972557 AVANZA “10 HITAM N-KOTA KM Sdkt Istimewa 142Jt Nego H%08155528584 / 7626234 972582 TWINCAM 91 PUTIH SE Ltd (N)BagusSkali Ori L/D TinggalPake Nego%0341-9049912 972552 INNOVA 08 SILVER E Plus Double Blower VelgRacing Bagus Terawat%085234997799 972558 DJUALAVANZAGVVTI2009 Abu2 Met Istimewa %082131032031 972622 VIOS2008GHitamMetalik Istmewa BisaKredit %0341-2825777 972640 COROLLA TWINCAM “90 SE Ltd 1600 Hi- tam (N-KOTA) An.Sendiri %0821 426 19 154 972598 **KIJANG LSX DIESEL 01**Silver L Pajak +BanBaru105JtNg%08125237199/9152650 972589 VITZ 05(Yaris BuiltUp) BiruMet Tgn1drBr Istw FullAudio Velg17”%0341-7000666 972476 TIMOR TIMORDOHC99SILVER(L)AC,AudioVRBgs BknExTaxi51JtNg%08883312070/7575321 971143 TRUCK TYTRINO6RODATH90(N)BakKayuSiapJa- lan Kond.Bagus 45JtNgo%087 859 97 1131 971174 SHOWROOM PRO MOBIL GrandLivina09;GranMax 09; Kuda 00;Katana99;Avanza11;Kijang94:Avan- za 05 DP Ringan Bunga Ringan Proses Cepat % 5435431 971534 VARIASI/SALON MOBIL ECOPIA150-TECHNO10 Ban Bridgestone Model Baru dg Harga lebih Terjangkau.Dapatkan di Toko Ban Purnama %7037921 - 418247 970808 MOBIL DISEWAKAN EAGLE: Avanz 200Rb,Inov 300Rb,Travel Mlg-Juanda Sby PP 60Rb %556600/7308111 971048 MOTOR DIJUAL HONDA KHARISMA X 2005 N-Kota Istimewa Hrg.6,5Jt Hub: 8841632 / 5368883 970795 SUPRA X125 CW06 DblDisbrake 8,5Jt; SUPRA X04=6,4Jt,MioSoul08=8,4JtNg%76 76072 970986 VARIO CBS th2010 Akhir Bln 12 Warna Pu- tih Hrg 13,5jt Nego Hub: 0341-8401001 972355 J.SLH1 NEW VARIO PMK2010 Hrg 9,8Jt; SUZUKI TITAN 2010 Hrg.7Jt% 9413099 /7335040 972635 KAWASAKI KAWASAKI NINJA 4TakHitam(Asli-N) FullVar+MIO CEON RC 2013 Bln2 Istw% 7568898 971557 SUZUKI SUZUKI NEX’12 Putih Hrg 11,5jt Nego Hub: 0341-7289888 / Ani 971042 YAMAHA OBRAL RAMADHAN UM DISC 2-3Jt Mio, Xeon, Vixion LbhLnjt Hub YAMAHA DNY% 7712177 971576 Yamaha Byson th’12,Jarangpakai,km 1000,N Malang,Pjk Baru,Ngo.H:08214141 5510 971872 VEGA R NEW 2008 Merah Hitam (N) 9Jt- NEGO TIPIS H:% / 9195 246 972534 SHOWROOM MUSTIKA MOTOR Honda!! Honda CBR 250cc’11(33,8)+CB150’13Putih(21,8)+Verza CW’13(17)+New Mega Pro’11(15,2)+CS One’08(9,9)+NewBlade’12(10,9)+NewMega Pro’11(16,5)%7718827/334846/331830 971039 MUSTIKA MATIC Promo!! Harga Gila Mio CW 10/11 UM Hanya 500Rb Angs. 299Rbx36(Termurah Se-Indonesia)Stock Ratusan Berlaku 21/6 s/d 1/7 %778827/28 44041/334846/331830 971373 SIDOARJO MOTOR DIJUAL VESPA J VESPA P150X Exclusiv ‘93 (W-Sda) Biru Mtl Jrg Pakai H:3,5jt %08175106608 972277 JOMBANG CARRY PU’89 PlatSDA 27,5JtSTW’84 A. PutroJmbo5Spit(AE)19,5Jt%081252820495 972307 PANDAAN HND JAZZ ‘08 L-Sby Full Ori Audio,TV, Trip- tonic. Mewah 150JtNg %089677859264 972046 SPESIFIKASI IKLAN
  • 23. SURABAYA AGEN “KENZIE.Adv”MAUPASANGIKLANJAWA POS~SURYA~MEMO DLL HUB:PETEMON BRT 22 %70235999/08563070541 969604 Peluang Agen Min.SariBuah,KacangKue Kering 03177378567,0817301318 Terbatas 972944 AC/KULKAS CV.TOP Svc AC,KULKAS,M.CUCI. Cuci30, Freon 50, Bkr/Psg100,JB AC Bks%71777784- 72040303 971158 MASTER AC/KULKAS78405999 Svc30 Freon 50 B/P100 SDA92155595 C.LAND 087854389666 TT AC Bks/GantiKompresor/ in-out door 971347 JUAL AC 1/2-5 PK Mulus, Juga Terima AC Kondisi Baik/Rusak %70106755-5965571 972244 ANTENA ANTENATVFokus20ChanelRp.85rb+Psg Garansi Uang Kembali Hub:71186612 972602 FOTOCOPI/LICHTDURK JCanonIR2000=6.5Jt6570,5075,5/6000MU- RAHKdgSari73%72824008/085232333797 971619 CANON NP6551 iR4570 iR6570 iR5000/ 6000iR6020:JagirSidomuktiIX/39%70077444 972414 KOMPUTER DcrKomp,Laptop,BaruBekasRusakDibayar DitmptCash03171386789/085334386789 968790 TerimaHargaTinggi!Laptop-iPadBGJUNC- TION L2/C42-43 81658899/082139378000 971149 Dcari Laptop/Komputer Normal/Rusak/ MatiOkDiambil082333678979/03177995558 971840 RUPA-RUPA ELEKTRONIK JUAL-BELI: PABX, FAX, CCTV. Hubungi: %031-70815645 / 81800001 . 971486 Jual PS2 hardisk +TV 29inc,PS 6 unit TV 4 unit, borongan. %0853 3595 7375 972720 ELEKTRONIK DICARI ANUGRAH Cari TV,PS,Dll Harga Tinggi %031-31455060,083831290655,082230250898 969419 DICARITV,LCD,PS2,PS3DLL Beli Dgn Hrg Tinggi %72725963 969941 *CARIRUSAK/BAIKTVLCDPS2L.EsM.Cuci AC DLL %031-77589006 -0838 5563 085 971353 CARI Trtinggi PS2, PS3, PSP, IPAD, XBOX, TV,LCD,BB,Dll 085785100057-71744300 972015 ANTAR JEMPUT ANDA Bth Sopir Pnggilan/Tk.Bngunan/Bro- ker Property Jasa lain %087855081132 972763 BIRO JASA “BJ”%031.70888306 Ij2Ush,Pspor Api/Nik ImbHo Merk PMA/DN Skt Migas Dpkes Alkes Klinik Apotik Siujk,jpt Stnk 969085 TERIMA JASA Cetak Plastik Injec Hub: Bp.Hari %082 353 6355 78 972964 SEDOT WC PUTRA BEBAS Mampet Ahli Saluran Air/ WC Dll Tanpa Bongkar,Atasi WC Cpt Penuh Tnp Kuras%70429763/71407713 Garansi 968375 BRATANG SEDOT WC Sda-Waru-Tenggilis- Rungkut-Kertajaya %81825354 - 77004199 968459 CV.MITRASEDOTWC%8791356/8712042 24jam Hari Minggu/Besar Buka/ada Diskon 968593 JAYA KARANG EMPAT %88621795 Penjar- ingan Sari %8782440 Tenggilis %5922404 968807 SUMBERREJEKIAHLISEDOTWCMampetBuntu Spj-Waru%7875368;Dmak-Wyung%71989983 969208 ANUGRAAtasiSluranMampet,WCSaptitank Cpt Penuh Dll%79400119-085732569130 970662 JITUAHLISALURANAIRWCMampetSedot WCTnpBongkar-Kimia%71628003-71777759 971165 SEDOTWCSURYAJAYA Rngkt%8686405 ; Krtjya%71279025 971718 “RAJAMAMPET”AtasiSlrnAIR,WC,KM,Dll yg tersumbat dg CEPATT%70971181/58206 777/08123123421/40015661 971823 SERVICE/REPARASI HALIM SERVICE %5673655 - 71968559 AHLI TV Sgl Merk Kerja diTempat Garansi . 968184 SURYA SERVICE%3712078/70279288 Ahli Ac/Kulkas, M.Cuci, W.Hiter,Fax,Tv,P.Air, Dispnser,P.Bola Krjkan DitmptGaransi 968505 SERVICETOSHIBA,MERKLAIN TV Kulkas MsnCuci 8793809 / 40279034 970416 ARSITEK RANGKA GALVALUM +pasang 105rb/m2, plafon+pasang65rb/m2hub.%031-91725983 968047 P-T TRUSS Melayani Atap Galvalum,Plafon Renov Bangun Rumah H:081233378477 970198 RENOV/B.BARU; RMH, RUKO, KOS2 AN, PAGAR, KANOPI, DLL %081233122992 971240 TERIMA BANGUN Baru/Renov Hitung RAB Design Hub:0819 3881 0096/77203082 Sda 972799 HANDPHONE NEW BB grs2th 8330-500 8530-780 8520- 12809330-9009650-1580dll08989727998 971835 KARTU TELEPON XL SUPER CANTIK (0817774777)=100Jt (Butuh Duit) Hub:0818405275 972483 BANK DANA CPT BPKB MBL/MTR ML’86, SHM Bng 1%nanRungkt59.PrssCpt%72522520/70730664 968738 KREDIT TANPA JAMINAN Syarat Mdh.Hub: Ida03188292715/085234770250.Prapen234 968994 TTP KARTU KREDIT/KTA Hy byr 20% dr ttl tghan terakhir hutang lns 100% Krukah Sel 7A/3%08561065881 969650 LANGGENG SEJAHTERA*DANA LSG CAIR (BPKB) %70161759/0818372724 Mgnti Krmat 64wyg 970147 KREDIT ANDA MACET,RUMAH MAU diLE- LANG, Ikuti ProgramKami,Dijamin Lunas, Le- gal Aman,Daftar ketik:Nama(spasi)Alamat SMS:081335162012 Jl.Rengganis1 Kediri 971090 DANA SEGAR JAMIN BPKB SERTIFIKAT % 71000729/7885046.BPR.INTANKITA,Ketegan.7 971385 BUTUH DANA CEPAT Jaminkan Sertifikat RumahBPKB Mtr/Mobil BisaTakeover Pasti- ACC Sda-Sby-Grsk %087855310600 MU6/59 971541 TAKE OVER Sertifikat 20-500Jt /Kami Dtg/ SMS:085774445874/ Sby-Sda/ Kp Mlg1 971966 DANACASHTNP/JAMINBPKB(mblspd)Giant DpngoroLt2CC11%70046889/087853412822 971932 BTHMODAL50-500JtJk1-5ThSHM/PtkD/BPKB/ SrtIjo/SHGB%085853338001/70002334 972206 BTHDANACPTProsesCptHnyKTPSimoHub: Ningrum%031-72810339/082230737433 972667 BIRO JODOH AKBAR 32Th PNS Islam,RUSLI 40Th Mpn Cr Istri H:KJ Sakinah%081357726989 Pin: 2A1F698C IkutiTemuJdh Tgl:30Jun(60Rb) 971420 Adip20 massageSuamiIstri Cina20-30 taun Garansi BkaSampai9taun081331054987 971867 Pria 34 ketrnchinesecrgdschnese/jndcan- tik tnp ank (jujur)%085648562537 972587 CARI JODOH: Gadis SA Kesehatan, Ajeng 25th,Islam Telp:085330211229 Tdk SMS 972574 CARI JODOH Jejaka BUMN Siap Nikah Tanto 42th,Islam Hub:03170439948 Tdk SMS 972725 HEWAN PIARAAN POM MURAH COKLAT Umur 3Bln STB VAK- SIN2,4JtNegoH:08983979232PIN:280E27C8 971760 *FORINAVPETERNAK-SuplayerAyamkam- pung,MlayaniGrosir-Eceran%03170568801 971880 INVESTASI BINGUNGUSAHAMdl500JtNgBsLaba20% Aman%081332732727Pin322334A2TP2Lt5 971976 KERJASAMA HNY 300RB DPT USHA PTG GABUS (Sty- rofoam) mdhpsti untung.MdoknSwh202 %71747385 969346 PluangUsaha Di RmhKupas2PlastikKertasHasilPastiUntu ng%085257169969 BukitBambe AN-16 Gsk 969830 DAPUR PANCAKE SBY MencariAgen Reseller Fee30% H:PucangRinenggo8Sby %88000568 970918 BAGI-BAGIUntungHomeIndustriPlastik+ Kertas, Open+Bahan Baku Hub: M.sulkan Ds. Klopo Sepuluh Rt.4 Rw.1 Sukodono Sidoarjo %77437910 -77680379 971596 PLUANG BSNIS AXA IncomeTnggi Bns Trip LN J.Karier I.Bonjol 129%085855861146 971514 DPTKAN BNTUAN DANA Dr Prog CV.BKJ Krm NamaAlmtLkp%085729797550 kli- urng Km8 972817 CR RekanBisnis FRANCISE-TNPMdl-Incme 100jt/bl085921750008/087774558822sby2 972348 KURSUS Kursus Potong Rmbt.Bs Gratis Hub:Mr.Ali %31418866 Kaliasin Pompa 55 970687 BLACKKURSUSMengemudiPaHeLiburan Belajar+Sim“A”799rb/10jam%92009972 971382 Kursus Rambut Dsr-Trp-Mhr Bonus Rias- Mntn Smpi Bs Dpt Ijash Hub:031-77080092 971948 6X LANCAR Bhs IngrisBs PrktekDgBULE Biaya 1jt Dtg KRMH. %087756721921 . 972702 “KURSUS MOBIL POLJATIM” 350rb/10jam %031-5939766,081357921183,081333340231 972372 GRATIS Les TK-SMA Kls Kecil 4-5orgLBB JmrAndayani+TmnAsriUtr(Pocan)72058891 972701 PRIVATE Bhs.Inggris Mulai SD-Umum Guru Brpglman H:031-81314778/081333335005 972453 MAKANAN-MINUMAN DAPUR PANCAKE SBY MencariAgen Reseller Fee30% H:PucangRinenggo8Sby %88000568 970915 “PLAZA TAHU” Kerjasama Peluang Usaha Makanan Untung Besar. Modal 3,5Jt (Dapat: Outlet Alumunium,Tenda,Peralatan) Hub: Ruko Grand City Regency A8 Jl.Rungkut Madya Sby %83316879-71790259 972145 MESIN/ALAT BERAT MsnctkKmoriLitron22640Sprint25-Olvr6 66-Ryobi3200PFA-480NA-480K-500N- Hamada602-770cd-RolndPratika-lipatSthal K66-Bnding158mata 081703600062 969926 J.Tandem Vibrator DYNAPAC Type CG 11 Bgs Msh Orsnil %031-71624062/8436598 971587 DIJUAL Mesin SKRAP 500mm, Hub: Kali- jaten 2 no.48 Sepanjang %031-71382273 971592 J.MURAHMESINCETAKRolan64x86,MsnJa- hitKawatBukuJerman%5685034-70227968 972091 MESINGERGAJIKingRexTaiwan1Hp-1,8m Rombong Bakso%70103366,08121641119 972697 PAKAIAN/SEPATU GROSIRAN Baju Hongkong Murah Utk Di- jual Lagi, Ploso Baru 49 %031-70878084 971412 CUCI GUDANG RIBUAN BAJU Wanita/Rema- ja Mulai 7500/PTG Beli 10.Gratis 1 Kemuning 47 Sby Daerah THR Hub.%5354987 972095 PEMBERITAHUAN HLNG BPKB Fortuner DA7557AQ 2006,Noka MR0Z69G60005778 Nosin 2TR-6219602 a/n Muh.Nasa’iH,YgMenemukanH:RktYKPRL2E/28 971519 HLGBukuUjiSB228384kl931duzanHerman Jl.Petemon Kuburan7Sby%085852440961 972093 Dicari Telah Hilang STNK Supra X 125, Panther 97, KTA TNI-AL, KTP, BPKB semen- tara MBL hub Mulyono 085731881355 971796 HILANG STNK SpdMtr L-2359-YN An:Siti Diana.F, Kandangan Rejo 28%08563354620 972138 Hilang STNK Motor Nopol L6238VU a/n Alim Wijaya. Hubungi: 03178332280 . 972154 HlgSTNKHondaKiranahitamnopolL3511 GH. an.Endang S.Y. Hub:77642600 . 972434 Hilang STNK Yamaha L-3486-ZM An.Siti Rochma Hub: %031-77509405 972904 Hilang STNK a/n Dwi Idamayanti Honda L5105DH.NC11D1CFA/Tth2O12%72639126 972946 HILANG BPKB MIO’10. L5110 QW AN DJUM- ALI JL.Botoputih 2/20.Hub.%081939393389 972935 HILANG STNK Nopol L-1417-GV An.Dulu Mulianah, Hub:%08113023456 972559 PENJERNIH AIR MRH BERKWALITASHrg9Jt,12,15,22,29Mbl SmberSndr%03177770776/081232379770 968188 TKSGROUPPeralatanAirMinumIsiUlang AMDK Hub:ITC Lt.LG 50-51%71701280 971254 FRESHCOLD prakitn depo AirMinum Isi Ulang Murahbrgrnsi91548933/085739537649 971586 AQUAFIL Spc FilterAir RO AMDK,DEPO Am Lkp+Tandon10Jt%081235395616/77754751 971738 RUPA-RUPA Jsbtwebsite1jt+Bonus Promosi diInternet%031-72665559 967947 MELAYANIBOR:SUMUR,Stros,Arde,Tandon, BusbetonAGUS%81232107/082131132269 968591 OBRAL BATIK Tutup Tk gk Ambil Untung Kualitas Bgs gk LunturSusut min 1Kd 03191823999 (Telp)/08123567841 (SMS) 970892 Pabrik permen chupa chups:225rb/dos isi 50x20 (beli min.25dos) 081333247989 971388 MEDICALCHECKUP185rb=30mcmBy1Get1 Free Akurasi Alt 90%%70224111/8410290 971399 DCR Distributor/Agen/Suplier Accesories HP Utk Mengisi Counter HP %5347211 971419 J.Murah MesinKupas Plastik Komplit 4JtCpt BU HariIni%72466972-081331022043 971766 Gulung/sobek kertas 4kg/hr.profit 2jt/ bl.dtng kartika niaga kebraon A33 sby 972040 Dioper Kntrkkn Usha Londre Daerh Wage Sda,Omset 5jt/bl,H:Rusdi.081233440044 971786 JualBoronganBkasDisplayGarmenLngkp 1 toko brng msh bgs(sda) H:92438256 971805 JUAL INTERIOR 3Lt,Kursi Reflexy 9Biji, Kulkas, Meja Direksi,GENSET %71411524 972053 DIJUAL PENGERINGBajuSistemOvenPake Elpiji Irit Hub:031-83641022 971916 JUAL ROMBONG 2 Unit Komplit Peralatan Kondisi Bagus Siap Pakai H:031-3538027 972863 DJL:MenteGelondonganMurah,MesinKupas Mente,Mesin Kupas Kulit Bawang,Kompresor 7,5HP+1HP Hub:%0811333290 972343 JUAL SEISI RMH:Mebel Jati,Lukisan,Jam Kristal,Guci,Lampu,Radio %03131111901 972696 INGIN BUKA Usaha Foto Copy di Rumah Modal Cuma 150Rb/Bln %031-72633073 972354 INGIN TURUN/NAIK BB Aman,Alami, Ber- garansiTlp:087853815550/081332123461 972624 AGEN TAHU PONG SUTRA+BulatTasikmlya ResmiDrDepKes%03171111869Pin:2156E436 972867 CRPINTUHARMONIKAbekas±6,5mx3m, 5mx3m Hub: %28893984 / 031-33562413 972980 J.SPRINBED bisa utk Homestay/Guest- House/Kos2an..Hub : Ibu. Dewi %88280793 972953 DIJUAL 3 MEJA Bilyard Bola Kecil Hub:031- 33223637/0878 5330 0881 972482 MATEREI6RBBARUHRG:RP.4000 SMS/Telp:0878 7098 1637 972513 J.ROMBONGBaksoBekas(RodaKecil)Kond.95% FullKayuUk:Panci34%081938675112 972533 AGEN PERJALANAN Tour A:SIN-MAL-THAI 8D/7N/Tour B: THAI-VIET-SIN 8D/7N 15,16,17 18 Jul’13/ Rp9,9jt(All-in)/By:Lintang Buana Tours Net Travel%031-91069767/031-31030455 971430 JT-WISATA RELIGI 1 Hr G.Kawi,G.Bromo, Batu,Mlg,Dll%031-3533066/082332330883 971922 CATERING CV.SRI RAMA CETERING mnrm ctrg Rmh Tangga,NsKtk(10-35rb)DLLhbgi:031.8911607 968724 GOSEPA CATERING,Pesta,Prasmanan Chi- nesefood.Info Hubungi : 031-5619475 971771 BAHAN BANGUNAN JUAL PLAT GALVALUM Polos Ukqp Lbr 90x Panjang 50M Tebal 0,35 H:087702592525 971515 SIDOARJO SEDOT WC PT.LANCARSIDOARJOSEDOTWC Tinja Hub:031-8921874 /8964978 970507 RUPA-RUPA JUAL BATU MANGAN Jumlah Besar Rutin Hub:%08121760324 972212 MALANG AC/KULKAS BERKAH JAYA SrviceJlBeli ACMbl/Rmh, KlkasM.CuciDRYER%0341-5334555/5430345 971139 RUPA-RUPA ELEKTRONIK JUAL BELI/TkrTambah TV,Kulkas,Msn Cuci Dll.Beli TV Rsk%8104567/081233774567 971206 SERVICESPESIALISTKameraDigitalHan- dycam Segala Merk Bergaransi%9600075 972648 BIRO JASA JASABANGUN/RenovasiRumah/RukoTrima Gbr+RabCpt,Mrh,Bermutu%082332597070 971777 ARSITEK ARCHITECTURE DESIGNBUILD RMH Ruko Cafe Resto Hotel,Vila,Kantor,PabrikIn trior Furniture%0341-405091 971195 BANK BPKBLSGCAIR,Sertifikat,KSUDANAPRATA- MA.A.Yani161Blimbing%0341-409111 970973 KREDIT TNP Jmn/KTA Syrt:Punya KArtu Krdt Limit 10Jt %085755873990 971329 KURSUS KursusMNGEMUDIAZARAHHy450RbAvan- za,XeniaDjminMahir%7623276/085234467625 972628 MAKANAN-MINUMAN DIBUKA TOKO Kue/Jajanan PsrOleh2 Mlg Jl.Jakarta 4 Ruko Sblh Alfamrt%579889 972166 PEMBERITAHUAN STNKMBLAVANZAAnSRIRAHAYU(N1924GK) Noka:MHFFMR6K34K001854NOSSIN:DA02339 972020 HLG STNK Mtr Yamaha’05 N5219AD An Su- geng S,Kemantren 3 Agus Salim Rt14 Rw3 972335 PENGOBATAN TERAPI Pengobatan Pijat Alternatif u/Sgala Penyakit %081234280098 Bs Datang 972141 RUPA-RUPA PT.ABE By Dr Boyke Bk Pel USAHA Utk ANDA. Dtglah28-6-13 Jam13.00-15.00 TAR- BATIN DINING HOUSE Jl.Ters.Wilis39.Dg Prod yg LR BIASA DASYAT.ANDA Sehat, Cantik Harmonis adlh Tujuan Kami.Dptkan Bonus 2nya CASH,MTRAVANZA H:Bu.SUWATI %081945399899 Jl.Alumunium 11 A MLG 970961 Djl 2 Gong Kuningan 2 Guci Kuno+4bh Batik Tulis Banyumas %0818 36 54 72 971037 Xtra Income Parttime 2-7jt/bln Pria/Wnt Usia min18th Serius!! %081233592807 972318 TRUN/NAIKBB3-50KgTNPDIETKETATRsaIce CreamGRSI%085853036081/Pin2A84E4B4 972663 PERLENGKAPAN RUMAH WALLPAPER...WALLPAPER mulai 25rb/m2 %7305678/085329098058/pin27797499 970889 WALLPAPER Mulai 25Rb/m2 %0341 7305678/085329098058/ Pin:27797499 972251 RUMAH KAYU Gazebo Jati Merbau Besi/ Ulin Minimalist Etnik Customed%7684147 972446 LANTAI KAYU Asli Merbau 360rb/m2 Sung- kay 270rb Jati Sono Custom%08175409919 972456 MOJOKERTO SUMBERHIDUPSEDOTWCTINJA %0321-324494 /324495 MOJOKERTO 970512 SABTU, 29 JUNI 2013 SURABAYA BIRO JASA BINTANG PATENT . . . . . . . . . . . . . . . 1X25 971658 ARSITEK CV JASA GUNA ,. . . . .. . . . . . . .. . . 1X25 971721 DUTA ATAP . . . . . . . . . . . . . . . .. . . . .1X25 972191 DESAIN . . . . . . . . . . . . . . . . . . . . .1X25 972234 KARTU TELEPON PULSA MURAHKU . . . . . . .. . . . . . . . . .1X25 . . . . . . . 964861 BANK GERAI DANA . . . . . . . .. . .. . . . . . . . 1X25 . . . . . .. . . .. 971332 KSP CITRA ABADI . . . . . . . . . . . . . . . . .1X25 . . . . . . . 971637 CITRA ABADI . . . . . . . . . . . . . . . . . . 1X25 . . . . . . . 971641 DANA TALANGAN . . . . . . . . . . .. . . . . . . 1X25 971693 KURSUS TAMAN PENITIPAN ANAK . . . . .. . . . . . . . . 1X25 967875 RUPA-RUPA DEPO AIS TRANS . . . . . . . . . . . . . .. . . 1X25 971715 21SPESIFIKASI IKLAN PAPERWALL UFO Graha Family E8 031-7380114
  • 24. 22 SPESIFIKASI IKLAN SURABAYA ADM-KEUANGAN ADM PEJUALAN Max24Th Blm Menikah Pny SIM-C Lam Ke Jemur Andayani 50/B-20 971363 MARKETING-SALES DCR MRKTING Wil Sby,Mjkt,Jmbang P/W Max30Th Pny Mtr SIM/Sdrjt Penam Mnrk Gaji,Kms,UM,UT CV Ke Jl.Dupak 138 Sby 971627 BTHMARKETINGSingleJjurPglmTgJwbU/ LuarKota/LuarPulau 085232837808 Mlt53 972650 RAGAM LOWONGAN Tele,SPV,Mrktg,BankAsingKaliRungkutRk RngktMegahRyaM7Lt3Debra%83606583 968730 BTHPRTWNTTDRDLMGj.1,5Jt H:Iwan %081333331978 Wiyung 5 969049 MAU BISNIS MDL 100RB RESELER Kra- jinan gabus, Untung100%.MdkanSwh202 %71747385 969336 BUTUH BYK”Pengupas plstikkrtas Di Rmh”hasil350rb/100kgbhnkerjaGrtislayan antar ambil grtis 7674988/085257169969 Bukit Bambe AN16 Gsk 969573 LIPAT KERTASTEH.Shari dpt 5box upah 350rb(50box=3,5jt)+uangBlnan.Bu2tn22G. sms.ROSA%081934165416 969934 DCR:ESTIMATOR,PELAKSANA SIPIL;MEP/ AC;Pelaksana Finishing,SPV Baja-#Lmrn Ke: Gading 2/36 Sby*Atau* 970385 KrjSampingn1jt-2jt/mgalatbahandrkntr bu2tan 22G SMS RATNA%081938645787 970334 “Krj DiRmh Kupas2/Pilah2 PlstikKrtas”Hsil Jutaan/ Bln%7674988/085257169969 PerumBukit Bambe AN-16 Driyorejo-GSK 970081 DCR BYK”Pemisah PlastikKertasDiRmh” Hsl Jutaan/Bln 7674988/085257169969 Bukit Bambe AN16 Gsk 970066 DCR SPG Gaji 1,750Jt+Kmsi+Bns Scoopy, Fresh Graduate.Bawa CV:Kedung Cowek 12 970284 BTH SPG/SMA/25TH/TB.160CM/SIM C+MTR + SLS REPRE/ D3/28TH/SIM C+MTR/ U/PT.LANCAR SETIA-DARMO PERMAI TIMUR III/51,SBY Telp. 0818752225 970792 LIPAT Kertas 50 box 3,5jt Ketik Sy_Nama_ Umur_Alamat SMS:08972088830 BBT16 971084 DcrTEKNISIAC,KULKAS,M.CUCITngSrabu- tan.DukuhSetro2/1A(CV.TOP)%71777784 971166 *DCR MEKANIK OFF ROAD+KARYAWAN SE- RABUTAN.Tempurejo65(kenjeran):031.3893190 971213 PRODUKSIGULUNGKERTASMODALHanya 250ribu.Wiyungbinamarga300GH:72447526 971215 DCR SPG, SPV.ACESS HP. METOOCEL Royal Plz Lt2,A Yani Sby,SMU 26th Gj+KOMISI 971288 DCRCPTTukangKayuMeubelMultiplexPgl- man ,Lam:Gn.Anyar Tmbk 134 %70984123 971342 CRGURUPRIVATKeRumahTK/SDMatFisKim IngMdrn%71707173-081615157788Trn24 971344 DCR PRIA Pglaman U/Toko Serabtan,Mau Kerja Keras PGS Lt1 A5/3 Sby %77111808 971362 SOPIR B1,B2,KERNET Max.40Th Utk Sido- arjo ,Lamr Ke:Kapasan 49 Sby % 70070011 971356 SATPAMMAX.40THUTKSIDOARJO Lamr Ke:Kapasan 49 Sby%70070011 971360 DCR Secepatnya Kapster Pglmn.Jl.Dukuh Setro 7A/12B.Hub:03170494771/51500302 971372 DICARI SOPIR untuk Toko.Lamaran Ke : Jl. Kenjeran 75 (Jam Kerja) . 971396 KURIR LPG Galon SIM C max29th Faslt Spd Motor Mess.A Yani70%03171255336 971404 Dcr Tkg Las Kontruksi Tng serabutan. Pan- dugo 141 Hub:0318715581/03170699692 971402 ADMIN WANITA MinSMU/SMK Max35Th Jam Kerja:Senin-Jumat Lam:Gemblongan 63F(Aneka Bangunan) 971504 ADMIN Llsn SMA Bs Komputer Pny Mtr DtgLsg:Raya Dharmahusada Indah Blok F221 971418 DCR KARYAWATi SMA 2013 Bisa Komputer Lam+Foto Lsg Ke: UD TOP Jl.Bunguran 27 971424 CR SOPIR+Srbtn DlmLrKota Kristen Max 25ThMulyosariBPDBlokZ3%087852595335 971381 BUTUH CEPAT Sopir Max35Th si PT.MYM Jl.raya Jambangan No.135-137 Sby 971423 DIBUTUHKAN SEGERA SALES, Produksi, Sopir Lmr Jl.Kalianak Barat 112 Sby 971625 DCR Tk BubutTkLasPglmLuarPulauGaji Oke Tambak Rejo 1/31%081330139175 971610 DCR LULUSAN STM/SMA Untuk Dididik Menjadi Teknisi AC Lamaran Lengkap+KSK Kirim Jl.Wonorejo 2/81 Sby %5451590 971595 DCR SOPIR B2 U/PasirSopir Sim A U/Bhn- Bagunan/Srabutan%70618085 PcrKeling10 971518 DCR Tkg Masak P/W ChineseIndonesia Food Usia ±50Th %031-8281306 A.Yani 240 971540 DCR STM Bangunan Pria Usia Max30Th %081231065825; International Village B5/8 971511 DICARIBEBERAPASOPIR,B1,Max40Th,Sby Brt.Hub:%03181234637 Kalianak Madya 2 971542 DCR SMK Kecantikan U/Salon,Lmr Simpang Darmo Permai Sel XV/97 Sby,%72317007 971554 KRJ ENAK LIPATKRTAS TEH,1Ktk/200Lb 70rb,dtgke HDN CabSby,Mlg,KdiriMADIUN diRUKO PGM SerayuTmr 1A/16-17Taman- Madiun.Hub:MUTIARA%085731379960 971580 DCR Sopir Pribadi Sim A/B1,Sabar,Jujur. Lmr+KSK Datang Ke Baratajaya 19/12 971628 BTH Krywti Jaga Warkop 2Sift krm Lmr ke Per.Mutiara Citra Asri E3/32 Sda 971621 DCR TNG KASAR SERABUTAN Kuat Ang- kat2 Pend Tdk diPerlukan Lgs Dtg Jl.Ngaglik 19 Sby Jm Krj 971606 DCR 1Tkg LAS LISTRIK4PEMBANTU Tkg Bengkel diKrjkan di Trosobo Lam Ke Bpk Cipta; Ds Sidorejo KM23 Jur Sby Krian(Sblh Pabrik Aneka Kopi) 971615 DIBUTUHKAN SEGERA PRT Yg Pinter Ma- sak Usia:35Th Jl.Pucang Anom III/30 Suraba- ya%031-70593928 (Tidak Menerima SMS) 971433 SGR SPG ButikBju DiPTC/Lenmarc Pglm GjTinggi;MargorejoIndA522%087853227872 971436 LULUSAN SMA TH’13 Bergab Dgn Perus Kami,Lam:Jl.Industri 312 Buduran%8942847 971441 DCR SOPIR Pglmn Jujur,TggJwb Kend.Sdri, Stasiun Kota 26F/A7%71034377/3536637 971432 CR HELPER Lam:Jl.Sukolilo No.100 Pantai Kenjeran Baru %031-3821354/77649242 971454 DIBTHKAN PRIA Min.SMA JujurTgg Jwb Lam+SKCK:SimoPomahan2/23Sby%92081083 971460 DCR PARTNER Bisnis DiBidang Industri Makanan P/F Time:3-10Jt/Bln,Tuk Jadwal WawancaraSMSNama,Usia,Kota,Domisili%0 8819354165-085852013500 971478 Bth Cpt Tnaga courier utk wil SDA.Hub :03172712121 Perum Banjar asri D 7 SDA 971495 Cari Segera SMK Max23 U/Gsk CV.JMT Kdg- Turi CC-5 Phone:78080513/083832493115 971451 BTH TNG PRODUKSI PABRIK 570.Secu- rity 580.Area SDA,Sby,Grsk Min.SMP Bu Ana :087702782744 Bungurasih Blok E/21 SDA 971607 BTH SOPIR SIM B2 Umum U/Angkutan SBY- JKT Lam:Indrapura Baru 351%08389951972 971603 LGS KRJ Wnt/Pria ADMIN SrabutanMarket- ing%70364899 SiwalanKertoPermai V/J-33 971599 Krywti/wan SMA single operator Game on- line Jl.Manyarjaya 14/10%081231457220 971577 DCR Pegawai Pria Utk Jualan TerangBulan Gaji+Komisi H:031-77500340 SWI 3/89 971626 DCR PEG.DEPOT,P/W 20-30th,min SMP, Single,Jujur,Serius Lmrn:Tenggilis Mejoyo AJ- 1 Sby %08993653775 971529 DCR Marketing Regulator MinSMA Lsg.Intv Ke:PT.JGI Jl.Karah V/64Sby%71734795 971613 Cleaning Wanita Penempatn D Perak lam- Kedurus 4.B/41.%085733218687-71671710 971620 DCRSalesAlatTulisKantor Min.D2 Max.32Th Pengalaman, Punya Spd Motor. SOPIR Max.35Th Diutamakan SIM B1 Pengalaman Luar Kota. Lamaran Ke:Jemur- sari No.44 Sby 971512 SALES, Pglmn Min2Thn, Sim+Motor, Bid KayuBangunan.Wiyung403%081217303382 971513 BTH PENJAHIT Sofa, Baju. GP,Mkn,Bonus. Bobby%085645686872. Randu Barat 3/20 971520 CR PENJAHIT Halusan, Pola, Borci Hub %0817 378901-3891338Lam:KarangAsm15/3 971522 KRYWATi SMK/SMA Sdrjt, Usia Max30, KRYWANSMPSdrjtMax30,RmhSktrManyar Sabrangan, Dtg Lsg Ke:Ngagel Madya 32 971605 KARYWAN/TiMinSMUUtkCounterMinuman Lam:Siwalankerto146Lt.LG-C9,TheSquare 971593 DCRSOPIRSim.BUmumPengalamanLuar Kota Lam:Dukuh Kupang Barat 9/11 J.Krj 971598 DCR Tukang Obras Kaos Promosi Berpen- galaman Lsg Dtg Jl.Lebak Rejo Gg.2 No.4 971602 PERUSAHAANASING Bth 30mrktg MinD1 Max35,Incme+Bns Mnrk,Krm Lam:Intiland Tower,P.Sudrman 101-103,Lt10-1B%60002838 971634 DCR 2 PRT SRBTAN Wnta,Laki2,SIM C+Bu jang, Tau Sby H:81900440 Rngkt Tgh 5A/23 971676 DCR TENAGA KERJA SERABUTAN+ADMIN, Syrt Punya SIM C. Lam:Nginden Kota I/9 Sby 971666 Karyawati S1 S.Inggris mx25th.Lgs:Tropo- do 1/229waru Sda081330492958-8913701 971668 DCR SOPIR B1 Srbtan Utk Ditmptkan di Bali,Dtg Lsg Jl.Kusuma Bangsa No.4 Sby 971672 KONTRAKTOR Cr Juru Ukur/Surveyor Pglmn.LamTamanGayungsariTimurMGN11 SBY/ 971671 DICARI KARYAWAN SERABUTAN Laki2 Min.20ThLamKe”JIMMYST”Jl.KedindingJaya Tengah Timur III No.49 972104 DICARI KARYAWAN SERABUTAN Laki2 Min.20ThLamKe”JIMMYST”Jl.KedindingJaya Tengah Timur III No.49 971706 DCR PEMBANTU RT Plg Sore 07-17.00 Domsli Gayungan,Waru Gaji 850Rb/Bln Hub: Raya Menanggal 32%8297708 971712 DCR KRYWTIMax35ThUtkJgStandMakan- an diCarrefour GOCI Lt.UG %72666577 971710 GIANT WARU tk sandal bth cpt krywti max 23th blm nikah 083849045050 cnd11 971773 SALESMAN Produk insulation diut yg pglm ke pabrik/indus, Lam:Rambutan Tgh 2/P65 PCI/ 971752 TENAGA Wnt 18-26Th,ADMIN/Pembukuan Hub:Tanjungsari 46 Sby 972088 DICARI SALES Laki Umur 20-35th Bag.Or- der Luar Hub:Tanjungsari 46 %7493285 971945 SALONBthPengelolaWanitajujurSupelter- ampil%71378621 Manukan Krajan33F/5 971734 BUTUH SOPIR SEGERA Platuk Donomulyo XV/2Surabaya%031-91440679/082131132233 971741 CARI THERAPIS SPA CAPSTER Wanita Pglmn PermataCandiLokaU-19SDA%8057856 971747 DESAIN INTERIOR/DRAFTER Gj Min2jt+ BonusBsAutoCad3DimaxKe:CVIMAGINEKlam- pisJaya6CKav.17A%58201287-71443355 971729 DCR PENJAHIT Wanita Bs MesinJuki Bo- rongan%031-72657773/085736502878Spj12/3 971727 DIBUTUHKAN KARYAWATI Utk Toko Min. SMU Max.30th Lamaran Jl.Demak 259 (IBM) 971960 DCRMEKANIKSEPEDAMOTOR Pglm;BalongSariTama 5D No.7 Sby 971955 PELUANG BERKARIER di Bln Juli 2013 Utk Posisi:ADM,Accounting,Umum.Dtg Langsung Interview Bawa CV ke Alamat: GD.Graha Bu- kopin Lt.11,Pangsud 10 Sby (HrJam Kerja ke Bagian HRD 971974 DCR Teknisi AC,KulkasYgBerpengalaman- Hub: 031-70827595 Lebak Timur 9 No.2 971829 Dcr Penjahit Baju Pesta Wnt %031- 34363612 /081358400475SutorejoP.I/5Mlysri 971854 DCRTehnisiDanHelperAC%8285828-7156 5632-081332485082Jl.Menanggal3/20M 971863 Bth Pegawai Toko Di DTC,Wnkromo, Wnt, Max30 Plg Sore Lam Lkp:Petemon Timur 53 971873 DICARI TK JAHIT/TK POTONG u/ Konve- ksi (Koas,Jaket,Kemeja,Training dll) Serius Dtg Lsg ke:Jl.Jagir Wonokromo 158 971755 LILYKURSUSPot.RambutW/PMdlbrBuka Salon,Mcm Manten Jw,Jahit.Kupang Panjaan 5/20 %70663805 971767 DIBTHKN TKG KAYU+Srabutan,Admin,Dra fter H:082336983791 Pergdangan Sedati 1A 971957 DCR PENJAHIT Dalam Halusan Fashion Hem Muslim/Kaos Rupa2 Juga Pengepul.Pe- temon Timur 41 971763 DCR WANITA Pglmn Komputer Admin, Sopir Luar Kota Pglmn.Jl Petemon Timur 41 971769 DCR SPG/SPBKOKI U/Stand CounterMall Lam: ManyarSambongan109%085730098111 971782 DICARI SALES WANITA,KURIR Lam Lgs Jl.Gunung Sari Indah VV No.1 Sby 971962 DCR SOPIR KERNET/TEKNISI/SPG/SPM Kirim Ke PO BOX 1442 Sby 972028 DCRTUKANGLAS,SOPIR,SERABUTANLulu- san SMA/Sderajat Lam Jl.Ngagel No.29 Sby 971984 BTH SGR A.MEKANIK MESIN Bensin B.MARKETINGMblBekasPnySimA+CBerpglm %5616006/71068007JajarTunggalSelK21 971988 DCR PRT WANITA 30-40Th Serabutan Tdr Dlm Hub:%08123536309-081553105297PS89 971993 DCR SOPIR Dump Truck Sim B2 Umum Berpglmn,Jujur;A.Yani Residen Kav.32 Sby. 972062 DCR PRIA Serabutan Max 35th Dtg Lgs Kali butuh 9 Sby. 971996 DCR ADMIN Wnt D3/S1 Akutansi Max 30Th Dtg Lgs Jl. Kalibutuh 9 Sby. 972024 WANITA ADM/SALES MAX 25TH, Belum Nikah.lmr:Istana AC, RMI Ngagel Jy Slt C10 972098 CR CLEANING SERVICE Wnt Utk Homestay, SMP/SMA.Datang Ke:Baratajaya 19/12 Sby 972099 Pelayan koki depot Ayam bkr gajiTinggi, dpt fas.Sms nama:085855958007 Tpd18 971918 SEGERA 10 Orang Wanita u/Proses Lipat Kertas,Dtg Lsg Tegalsari 58 Sby J.Krj 971927 DCR OPERATOR Internet Wanita MinSMA Max30Th, Lam Lsg Ke Jl.Kenjeran 482 Sby 972071 DCR KARYAWAN Gudang Serabutan Pria, Max30Th,PlosoTimur4/40%3890546SEGERA! 972066 LOWONGAN ABK Pemula / Pengalaman. Jl.Jam bangan15%58251195/085645311183 972058 PMAISSEEKINGForCandidateFor:1)DRIV- ER For Expat Age 50/55 Max; 2)FEM ADMIN Asst Min 24 Gpa Min 2,80. Application Incl Photo To Be Emailed: diana.hotrox@gmail. com / Hotel Bumi Sby Prm 03 971953 KRYWN/Ti MinSMU Utk Counter Minuman Di Laguna Pkwon(16.00-24.00) Lam:Bong- karan 79,Sby 972054 CRSTAFFADMINSMA/D120-25ThBsComp Palm Beach F6/20 P.City Hub:%70348602 971772 CR TUKANG Kanvas Rokok,Pny Mtr,Gj Pkk +Komisi, Bhaskara Sari 11%081331179986 971768 KASIRWntKmunikatifRamah23-30thMinD1 LamSOLARIS,Siwalankerto 141C %8481193 972085 CR SOPIR LuarKota Sim A,Max30 Min Smu. PrumPndkMutiaraBK-14Sda%03188173092 972038 DCR KRYW u/dididik teknisi STM IT,Elektro uletRjin ju2r max30th.kdungsari73 972084 DCR SEGERA PRT BisaMasak(kerja 7pagi- 3sore)SUSTER u/anak 2th(kerja 8pagi- 9malam).BabatanMukti V/E-4 Wiyung 972018 DCR Sgr Tng IT Support Dsg Interior Krm Lmr PT HESS Ketintang Selatan 79 971995 CR Wnt ADM Resto,SMA/llsan baru 22th Ry sukomanunggal jaya52%0838.9471.8100 972051 CR INSTR KOMP DESAIN GRAFIS. PRISMA Manukan31j/4.Hub:085731011301,71729477 971780 CR T.BORDIR HRIAN70RB +PJHIT HLS WNT+PAYET Borongn:77770929/ 0821 77770929 jmp1 971848 DCR U/BAGIAN ADMIN bsKomputer, jujur,wnt 30-40th.ditempatkan diPandaan. Lam:PO BOX 4321/SBDK/60225A 971855 DiBthKan Karyawan/Ti Toko Srbtan Tdr Dlm Phone:081803161197P.ManggalaA4/11 971887 DCR SGR BYKKRYWN/TIUTKDEPOTDROY- ALPLZKRMLMR.RY.KUTISARIINDAH112SBY 971895 CRSTAFADMINSMA/KSdrjtP/Wmax40th. PSJ G9 No3 Gedangan-SDA.085230821878 971865 CARI Operator Diigital Printing, Tkng Po- tong Kertas Hub Rungkut Asri RL1C/7 971879 DCR OP Game OL Pglm Dtg Lsng:Tmn Pon- dokJati AD-1A Spj%031-91366535(Tdk SMS) 971958 CR 1.SALES+1.Bag Serabutan(Kurir) Kend Send Lam Lengkp(Via Pos Kilat) Jl.Amarilyst Resident 1 Pondok Candra 972082 CARI SALES Max30Th SMA Jujur,Rajin,Ulet Pny Kend Send Lam(Via Pos Kilat/ Patas)Perum Deltasari Indah AV-27 972086 DCR MEKANIK Spd Mtr Bs Semua Jenis Mo- tor Jl.Jetis Kulon I/A-17 Wonokromo 972090 BTH PENGAJAR KOMPUTER,Inggris,Mat,Ro botic Lmr Ke Jl.Tidar 282 Sby 972108 DICARI CLEANING SERVICE Gaji Menarik LamKe Jl.Dr.Moestopo 8-A%081515100706 971874 DCR Tukang Almini, Kayu+Serabutan. Baratajaya 18/37 %0878 5369 7020 971977 SPG Toko Baju Di DTC Lt.1C,Wnt Max.22th, SMS: 0821.400.89.321 971969 BTH Karyawan/ti utk Bank Asing, Jl.Dr. Soetomo136-138Hub:Dewi%081703960040 971992 Bth Wnt Bs Masak,Single,Max.25th Asli Sby.081931086937/081914531338 KutSel8 971859 CR SOPIR PGLMN Pny Motor Domisili Sby Barat.Bw Lam:WTC Lt.4 No.403%78129900 971830 Sopir B1 Pglmn SLTP Gj 2,2jt Jamsostek, Rambutan 2/D254 PCI max.40th % 085755920543 tidak terima sms 972087 HELPER/Kernet Srbtn Pglman,SMA sdrjt gaji Jamsostek, Rambutan 2/D254 PCI %085755920543 tidak trm sms 972075 DCRT.TERAPISL/PPengalaman/Tdk,Komisi Besar 45% Hub:P.Didik CITO Lt Dasar LS23 no.1-7 MuliaRefleksi 087855069709 971987 TOKO TAS ITC/PGS Dibthkan Krywati Max. 30Th Berpglmn%70367789(Tdk Trima SMS) 971935 CR KRYWN/TI U/JagaStanPujasera Lam: Lebak Arum 6/79B%081938675112 Intrv- 7Malam 971937 LBB BTH GURU Mat,Fisika,English U/SMP ;Candi Lontar Kulon I/32%085232040400 971901 LOWONGAN KERJA BENGKEL DCR D3/S1 TeknikMesin/Industri BisaLas Bur Bubut Milling AutoCad www.emputanjung. com %031-70588755 KebraonGang 5Sby 081331200920 972025 CARIKaryawatiPglmanBikinPisangKipas, FoodFestival+Royal Plasa%0818512777 972077 DICARI OFFICE BOY Ada Spd Motor Lam: G- Walk Shop House A1-3 Citra Land 971862 BTHKepToko,KepGdg,AdmGdgu/Sby Bali,SPG/SPBu/DtmptknDenpasarSbyLam: Ruko Panji Makmur C30(PanjangJiwo46) 972140 KRYWAN/Ti MinSMU Utk Counter Minu- man SLURP Di Masp Square Lam:Achmad Yani 73/K03-3A Sby 972177 DIBUTUHKAN SPG Stan Makanan Di BG Junction-Bubutan. SMS:08385952004 972182 DCR SOPIR SIM A/B1 Usia 27-45th.Lam Krm:Rungkut Mejoyo Selatan 9/32 (UBAYA) 972135 DCR P/W max25th SMP srbtn u/ dpot sms nma,almt.03170211390.Ldah klon 26 sby 972142 SGR! Ass Apoteker WNT Single.LamLgs: KartikaMasReg44WaruSda.081330350789 972196 KERNET u/Pgrm Brg+Bag Pgrm brg simC kend sdr mx25th:Ruko klampis Megah H-28 972188 KARYW/TI FoodDrink dRoyal/Cito/UK- petra/Goci SMA Mx25th Sift700 Fultime1jt SMS NmaAlamtUsia 088801481452 Drmo1 972248 BUTUHPENGEMUDI,SIMA/B.JL.Darmokali 2-6 Sby. %085649734734/ 087754141144 972357 TEKNISI AKUNTING MIN SMK AKTANSI LAM KE:HITECHMALL LT IA/ 71A%081703696873 972243 DICARI CEPAT Sales Tng Serabutan Pria Min SMA/Baru Lulus Lam:Perum Sedati Per- mai Jl.Sriti Blok GG-52 Waru-SDA (Msk griya Sedati Indah-Tropodo) 972265 CARI Pengasuh PenitipanAnakWnta/SMA Krsten WigunaTghI/25%8720217-72965676 972242 DCROPRTRPSGj1jt,SMU,Pria,FasMess,Urip Sumoharjo 56 Kptran 081553551984 972409 KARYAWAN PRIA Max35Thn,SpdMotor Sdri,Sopan,JjrH:8796780RukoRktMakmurB-8 972821 SOPIR COLT DIESELSIMB1PglmnMin25Th ,GriyoMapanSentosa EJ.26,Sda%71185516 972830 CR ADM WNT SMA/D3 Max.30Th,Py.Motor BsPembukuan,Comp,TjBatuPerak%3538027 972855 PEMBANTU RUMAH TANGGA Tdr Dlm, Villa Bukit Mas Mediterian Blok G/37 %71063070 972884 SOPIRTRUCKTRONTONWINGBOX Sby-Jkt/Kota-KotaJawaTimurSIMB2,Letjend. Sutoyo 271 %081330994567 972877 CRSALESCOUNTER/AdmCounterD3/sdrjt 20-30th Lam Ngagel Jaya Sel RMI L-20 972849 DCR TENAGA PRIA U/Kirim LPGAir Galon Dll H:OASIS B-15 Sedati %081332189540 972905 JONAS PHOTO Membthkan Karyawan/Ti Utk Toko, CLEANING Service, Wwcr Lsg 1-3 Juli, Pk 10-12 Di Jl.Selamet 15 972984 DCR KAPSTER Gaji Menarik DtgLsg Ke Pojo’an Salon Jl.Kutisari Selatan 11,Sby 972275 BRIDAL BTH Penjahit Halusan Tukang Borci. Hub:%08175277495 Karimata 8 Sby 972326 URGENT WORKToSingaporeOperatorMsn, Teknisi,Sopir Pny Paspor%081232636788 972257 DICARI SOPIR TRAILER SIM B2 UMUM Pen- galaman Lamaran Jl.Kalianak 51-Y 972425 **KRYWNTOKO-GAJIMENARIK** Wnt,SMA,Single Max24th,Penam Menarik Toko Aksesoris Petra Jl.Kapasan 153 Sby 972708 DICARIPENJAHITBajuBisaMesinJukiTng Srabutan %031-72427905 Jl.Ry Manukan Wetan 24 Pergudangan Best Jaya C-1 972735 SOPIR SIM A+C Bs MATIC Srabutan di Pter- naknAnjing.DarmoPark 1/2c/8%81855520 972391 BTH STAFF OPERASIONAL SMU Pria max. 25th. Kirim Lamaran :Jl Jemursari 14 Sby 972416 BTH OPERATOR Forklip Pglm;Admin Wnt Cleaning Servis.PT.SiS Mangga Dua B5/10 972949 DCRSOPIRB1,ADM,Ops,OBlmrnke:PTNU- SANTARACARGOLOGISTICSRukoPengam- pon Square Blok H-20 %0313544750 972779 DIBUTUHKN KARYAWAN u/Srabutan Min SMP Karyawati u/Adm,Komputer Min SMA 18-30Th Lam:Bubutan 107 972317 DCR SOPIR Berpglmn Sim B1 Umum.Lam: PT.Damar Kencana 1-Dupak Rukun 220 Sby 972452 DBTHKN PRTBby Sitter u/DlmL.Pulau. Bngurasih%087702866703/082140274223 972785 AYO MARKETING SALES Semangat- Pandai Bicara-Menyenangkan,Lamaran: Darmo Permai Selatan No.30 972766 TENAGAHARIANPRIALgsngKrjH:Pergu- dangan Mutiara C7 TambakLangon 7483880 972563 BUTUH SGR TiketingAdmin Lulusan SMK. Kirim CV ke Jl.Raya Ngagel 213%5049245 972611 CR PEMBANTU SRABUTAN Ngimat/Plng Sore Gj MemuaskanDtgLsg:BarataJaya48Sby 972762 DCRKRYWTISRBTN,TkgLbgKancing,Jahit Cln Pjng Mesin Juki:Ry Jemursari 31 972301 DICARISPG,DRIVERSimA/B1Kirimke:Teh Jawa Pergud 88 B-20 Pabean %8687901 972634 Bth KRYWN SMP/SMK,Training3bln+me ss+gaji hr-an;AC,Instalasi listrk.70646754. BJKatamso 3/70A 972352 DCR SOPIR Sim.A+B1 Gj 1,75jt;Srbutn 1,5jt;Adm;Waiter/s Lam:Kalikepiting 101 972379 DCR KARYAWATi Single Utk Toko Baju MuslimLamarn:Jl.DharmahusadaNo.108Sby 972285 DCRTNGP/Wu/WarkopBsr(WrgGaul)Samp- ing Tmn Pdk Jati Thp II Suko%72040629 972843 DCR TENAGA TUKANG POTONG Bisa Tidur Dalam Hub:Jl.Dinoyo 131-133 Sby 972914 CARI DRIVER MAX.40TH U/TRAVEL Sby Malang Lam+Foto Ke Basuki Rahmat 64 Sby 972921 MEMBUTUHKAN KARYAWAN Untuk Grosir Cosmetic Sim.C + SMA. Lam:Kembang Jepun 27/2 %031-3551440 972384 Cr Supir Truk Engkel DlmKotaTenaga ang- kut srbtn sembako,Pucang Kerep 5 sby 972874 BTH Karywn LK SIM A/C TAHU LISTRIK/AC Dtg/Lmrn Kpg Gng Tmr 4 C/9 %5671947 972986 MONTIRTRUKColtDiselPglmTdrDlm.Babat- nPratama 19 BB49 Wyg Sby%03177591949 972967 BTH Sgr 25Adm P/W 18-50 SMS Dt:Bu Riya- ma SE Personalia RewinD7%085792924033 972913 DCRSOPIRPengalamanMinSMPMax40Th. Lmr:Karang Empat X/35 sby. 972918 BUTUH Cpt 20staff Promo Buku Ramadhan %031-5043882 Ngagel Sltn Rk RMI F29sby 972661 Cari Sopir Utk Rental Mobil Datang Lang- sung Dukuh Kupang XIV/28-30 Surabaya 972783 AstSablonMax30thRk.PermataJemurHan- dayani50%03191081759/085730000496 972798 DICARI Tukang Sablon Kaos Sby Timur Hub:0813 3322 0022 Wisper1 972822 SGERA SIST. Apoteker Apotek Jl.Abd rah- man 62 Pabean Sedati Hub:03-172021930 972868 DCR Karyawati Untuk PercetakanHub :70494981 Manyar Kertoarjo XI/23 972591 DICARI SOPIR Colt Diesel Sby-Jkt MinSMA B1-Umum LamKe Manyar Tirtoasri I/33 972676 PT.B.MANDIRI Bth 20Krywn/Ti U/ADM, Gdg, Staf UmumPengelola MinSMA/SMK Max 25Th LamKe Jl.KarangMenjangan No.115B Jojo- ranSby%031-70879375(AdaFasAsrama) 972681 DCR GURU SD Wnt S1/S2 B.Ing/Mat Lama- ran Jl.Slamet 43 Sby Tlp:5311199 972734 LIHAT HAL 23 SABTU, 29 JUNI 2013 SURABAYA RAGAM LOWONGAN LOW.BIRO PERLINDUNGAN HUKUM .. . . . . . . . . . 1X25 967884 LOW SECURITY . .. . . . . . . . . . . . .1X25 . . . . . . . . . . . .. 969997 LOW CLEANING SERVICE . . . . . . . .. . . . .1X25 . . . . . . . . . . . 969998 LOW PENJAHIT . . . .. . . . . . . . . . .. . .1X25 . . ... . .. .. . . 969999 COUNTER SALES . . . . . . . . . . . . . . .1X25 . . . . . . . . . . . 970008 LOW.JL RAYA SEMAMPIR . . . . . . .. . . . . . 1X25 970032 LOW.PERUS PART MOTOR . . . . .. . . . . . . . 1X25 970483 LOW,KLINIK KECANTIKAN .. . .. . . . . .. . . . . 1X25 970515 LOW.PRIMA MANDIRI /. . . . . . . .. . . . . . .1X25 970518 LOW. HADENA INDONESIA SOFIE . .. . . . .. . . .. 1X25 970824 LOW.KABAR GEMBIRA . . . . . . . .. . . . . . . 1X25 970826 BEKERJA DARI RUMAH . . . . . . . . . . . . 1X25 . . . . . .. . . . . . 971334 PT.ATS SOPIR . . . . . . . . . . . . . . .. . .1X25 . . . . . . . . . . 971335 PT.LENKO SURYA PERKASA . . . . . . . . . . .1X25 . . . . . .. . . . . 971337 LOW.DIBUTUHKAN SEGERA . . . . . . . . . . . . . . . . 1X25 971425 PT HADENA IBU KENDEDES . . . .. . . . . . . . 1X25 . . . . . . . . . . 971639 LOW KSP CITRA ABADI . . . . . . . . . . . . .1X25 . . . . . . . . 971643 LOW.FHS JUNI . . . . . . . . . . . . . . . . . 1X25 971690 LOW.CITRALAND ADMIN . . . . . . . . . .. . . . 1X25 971695 LOW.PT NEP . . .. .. . . . . . . . . . .. . 1X25 971705 LOW.PERUS DISTRIBUSI . . . . . . . . . . . . ..1X25 971708 LOW.SOPIR SERABUTAN . . . . . . . . . . . . . 1X25 971714 LOW.DICARI SALES COUNTER . . . . . . . . . . . . . . . 1X25 971735 RUNGKUTMANANGALHARAPANGA-20..... . . . . . . 1X25 . . . . . . . . . . . 972120 LOW.BELAJAR SAMBIL BEKERJA . . . . . . . .. .1X25 972181 LOW.LANGSUNG KERJA ,. . . . . . . . .. . . .. . 1X25 972193 LOW.IBU CHANTIKA . . . . . . . . . . . . . .. 1X25 972197 LOW.IBU PRISCILLA . . . . . . . . . . . . . .1X25 972200 LOW.PELUANG BISNIS . . . . . . . . . . . . . . .1X25 972208 LOW.OPERATOR KOMPUTER . . . . . . . . . . . .1X25 972213 BABY SITTER LOW.IBU MAYA APRIL . . . . .. .. . . . . . . 1X25 970793 WIDIO MEI . . . . . . . . . . . .. . . .. . 1X25 972185 SIDOARJO RAGAM LOWONGAN BUTUH SEGERA IBU ALFI . . . . . . . . . .1X25 . . . . . . . . . . . . 970813 BUTUH MENDESAK IBU SEKAR . . . . . . . . . . 1X25 . . . . . . . . .. . 971020 MALANG MARKETING-SALES LOW PUPUK BINTANG MJ. . . . . . . . . . . . . .1x25. . . . . . . . . 971287 LOW BIMAJAYA. . . . . . . . . . . . . . . . . . .1x25. . . . . . . . 972122 RAGAM LOWONGAN LOW HOME INDUSTRI. . . . . . . . . . . . . . . .1x25. . . . . . . . . 970787 LOW LETJEN SUTOYO. . . . . . . . . . . . . .1x25. . . . . . . . . . . 971717 LOW.TAIWAN . . . . . . . . . .. . . . . . . . 1X25 972160 LOW.MC DONALD . . . . . . . . . . . . . . . . .1X25 972168 LOW.RESTAURANT . . . . . . . . .. . . . . .. . 1X25 972204
  • 25. 23SPESIFIKASI IKLAN CR TRAPIS REFLXIP/WGP1Jt+KmsiDtgPe- temonBrt122Sby%031-70760779TdkSms 972685 DICARI ASM MARKETING U/BANK ASING Jl.Upajiwa 17C Ngagel %5012612 Up.Risza 972870 DICARI SOPIR Dump Truck Hub:PT.EKA PS Jl.Kalianak Barat 55-A %7492363 972444 DCARI DESAIN GRAPH,Min SMK bs Banner PinKrtNama,DLLLam.DUKUHKUPANG20/64 972505 RUDISALONCrHairStylist(TkgPotong)Pglm LebakJy2/2D%71092050/088805101938 972873 MEKANIK PGLMN Ganti Oli/Psng Variasi/ SalonMobil Diut Bs Setir 70527102 SK1 972547 LOWONGAN Pengemudi SIM A/B Penghasi- lan 2,5Jt/Bln Hub:085731667705 Datang Lsg Test Ke Jl.Rungkut Tengah 76 Sby 972439 1.SPV Security,Pria,Usia 26s/d45th ,SMA /Sdrjt, diutmkan Pny Sertifikasi2.Staff Oprasional,Pria/Wnt Bidang Pengamanan, Ber- pnglm diutmkan Bsertifikasi,Usia 27s/d 45th, Min.D3sgljrsan3.CalonSecurity,Pria/Wnt,Min. SMA/Sdrjt,Usia 21s/d 35th 4. Driver, Pria,Min. SMA/Sdrjt,Pny SIM A,Bsedia Lr Kota,Max28th 5.OB/Cleaning Service, Pria/Wnt, Min SMP, Max26th.LmrLsg;Jl.MulyorejoTengah22Sby 972413 DCR WAITER/SS,ADMIN,BARISTA, Krm ke Jl.Rungkut Asri Tmr 12/25 %03192521616 972993 TENAGASERABUTANPriaTdrDlmU/Depot Hub:RayaWistropT17%71586465TdkSMS 972755 CR:1.ADM (W) Min.SMP Max.20Th;2.ACC Claim(Pria) Min.D3;3.Srabutan Min.SMA Tggl Dalam;4.SPV Min.S1 Max.25Th(34)Pglmn Expedisi(23)Lam:Jl.Demak 250 Sby 972488 DCR APOTEKER Pendamping Wnt FulTime U/Apotik DiSbyBrt Ada Mes%031-7291 3071 972500 BUTUH 150 TKI Biaya Potong Gaji Jl.Otista 19 Jaktim Hub:0877 6444 3404 972467 DCRADM,SALES,Sopir,SrbtanLam:RukoPen- gampon Square E2%3573803/08883756633 972418 DIBTHKAN KEPALA QC L/P S1 Farmasi- Apoteker KrmDi:Jl.Ry.Bronggalan No.12 Sby 972711 BTH SMK KOMP Pria Br Lulus Jajar Tungal Utara 1/26%031-5624475 (Max 1 Juli) 972834 DICARI SOPIR KANVAS U/ Air Minum Min- eral Ry. Bendul Merisi 73 %085755545672 972954 DCR OPERATOR Mesin Cetak Oliver Office Boy. Lam:Tempel Sukorejo I/119 Sby 972516 TKGLASPagarPglmn;MedayuUtara186Rung kutSby%082141938483/087754144783 972454 BABY SITTER PRT SUSTER TANPA POTONGAN GAJI IBU WATI. Jl ketintangBaru 16 no 21 Sby. T;70044405-081331100355-085730098057 968174 BTH Sgr Baby Sitter Max35 Dklinik Al Azhar DupakBandarejo 23Sby%08175215478 972994 SIDOARJO RAGAM LOWONGAN BTH Tng Serabutan Laki2 Utk Bengkel MinSMA Dom Sda Lam:Jl.Gajah Mada 28-Sda 971408 TENAGA BORONGAN BENANG max 40th. Jl Jenggolo 1 No.54 Sda Tlp:0857.8513.2789 971550 DCR ADMIN+TNG LAPANGAN S1 Bs Komputer,B.Inggris Sopir Max30Th Candi MasE/26Sda%03181648825/081234543636 971505 DCR WNT Utk Bekam Min SMA 20- 26Th Jl.Pahlawan 82 Sda H:Bpk Agung 0813575808 971793 DICARI MARKETING OPTIK Datang Lang- sung:AlamMutiaraC2/21Sda%03177319646 971834 DCR TKG Bubut Hub:CV.Armas Putratama GOR Delta Kav.13-14 Sda %031-72433778 971904 BUTUH ADMIN P/W, SMU/K. Hub: Ibu Deb- by 081.232.949.829 (Ruko Rewin P7/4) . 972306 DIBUTUHKAN GURU LES Privat Wil-SDA %031-31431136 Perum. Puri Indah Blok H-5 972254 SERABUTAN PRIAMax35thLam:Pergudan- ganTriTantamanB28TamanSda52601650 972577 DIBTHKNTNGProduksiSDSMP20-30thn. Brigjen Katamso 3 Janti Waru%70011732 972581 DIBUTUHKANMEKANIKMobilHub:Perum Citra Sentosa Mandiri A/6 Sda %71076491 972802 SOPIR bisa Serabutan Toko Mebel max 35th.Garuda100Buduran%081259590425 972588 SOPIR Bs Srabutan Toko Mebel Max35Th Garuda 100 Buduran Sda %081259590425 972569 MALANG ADM-KEUANGAN DCR ADMIN Wnt Max.24Th Min.SMU Bisa Komptr Lam:Letjend Sutoyo 8A Mlg 971308 MARKETING-SALES DCR SALES Exclusive Motorist Jl.Raya Banjarejo 145 Rt01Rw02 %085649709575 971008 DCRMRKETINGu/DealerMinSMAPnyKend. SdriLam:ProMotorJl.P.Suroso15%410000 972236 RAGAM LOWONGAN DICARI P/W Sma Mall Mog/Matos Fulltime Po Box 4444 Ml 65101 970012 CARIKARYAWATICentralLondriPusatCuci Profesional Jl.Patimura2C %368949 970780 Dcr Pria/Wnt Lulusan SMA/Sdrjt Usai max. 30th Single utk Peg.Toko,Jujur, Berpenampi- lan Rapi dan Sehat.Syarat:KK,KTP,Foto,Skck. Lamrn krm ke:Jl.Simpang Dieng 23 Mlg 970834 DCRKrywan/tiTokomax25th,Jujur,Komun ikatif.Lam:Hokky Motor,Ry.Bandukan 32 970833 SPG Butik Wnt Max25 MinSMA/D3 A.Yani Utr 1 Riversed Singosari%081331217875 970861 CR SOPIR + Wnt max.30th + Kuli Angkut. Lam.Panca Ragam Anyar,S.Parman 20 Mlg 970883 KrytiFamilierComptr/InternetWebs,Gj.1jt. 25th max %0838 341 11 601 970891 Dcr Cpt Kary Part/Fultime INCOME sd 5 jt. Lgsg Kerja.Info: 081334405858 ZArfn53 970904 DCRADMINBAGIANKIRIMLamrnKirim Ke:Jl.Sarangan No.1 MLG%7558588 No SMS 970987 BTH SEKRETARIS D1/D3/S1 Kuasai De- sain Grafis Multimedia Digital Marketing Web,KendSdr KrmLamKe:arianidr@yahoo. com%0341-9314000 970965 DCR PENGAJAR TK-SDJamKrj 10-18 Tlaten ,BsComp.MinSMA/Sdrjt-S1 SglJur %7358081 970970 KRYW/TI Operator Fotocopy dll Hub:Sen- trale Fotocopy,Ry Tlogomas2 Dpn Unisma 971006 BUTUHOP.WarnetHub:JallaNetJl.Kalpataru No.69 %085755444496 971011 DBTHKN 1 Guru TA Darul Ihsan D2 Pgtk/S1 Paud Jl.L.Sutoyo 3/60 %08125295114 971013 DCR 1PnjagaMasjidSn.Kalijogo(AzanBer- sih2) Jl.Tirtonadi 13 %08125295114 971014 DCR SOPIR+Sales Bhn Bgnan Max 30Th Lam Bwke:Jl.GatotSubroto5Mlg%325362-324675 971019 Dcr SOPIR B1 utk TK.Bangunan.Lam.lsg ke: Jl.Bandulan Barat No.11 %81.36.968 971038 1 Wanita Marketing/Administrasi dibthkan Biro Iklan,min.SMA,SIM C,Insentif Besar.Lam: Wilis Indah A-6,Mlg 971044 Dcr SUSTER u/Merawat Lk2 Jompo diRT Tdr Dlm ±35th,Tenaga Baru IV/15A%408160 971049 Dcr PENJAHIT Kaos Bs Obras Jait. Gj+Trans+THR. Jl.Manggar 23 %7369506 971050 KERJA DIRMH NEMPEL TALITEH.1Ktk/ 200Lbr 70rb+tnj blnan.HDN Ruko WOW A10 Sawojjr Hub:UMMY%085736238052 971225 KRYWAN U/DEPOT Rmh Makan Wil. Sawojajar Krm Lam.Kebalen Wetan 59 %081938397462 971202 PRTGAJI750Rb/Srabutan/TdrDlmDibawah 50Th:Bu.ANA%0818531023/461293 971167 DCR MAHASISWA Usia 18Th, Wkt Flexibel 4Jam/hr Income.1-8Jt/bl %087777708206 971192 BthCptTkangKusenPntHarianPnglmn1 Tng Kasar.0341-3151831 Sidomakmur85 971198 DBTHKNWNT.u/KafeRestoDimalay/Sga- pre GJ.25jt.pisang101 mlg. %087756848180 971184 DCRBAG.CreambathPglmn/TdkSlnRahman- aya Jl.C.Sewu Kv4 Blimbing%0818381804 971106 KARYWN/TI Single max.25th.Lam ke: Ta- man Cafe Resto,Ruko Simpang Wilis 1A 971303 BTHMARKETINGAccountOfficer,PriaSim C Lam:Jl.Tumenggung Surya 131 A Mlg 971328 BTH SGR Kapster Max.27Th Lam Lsg C.Waringin No.6 Salon Candra %7694999 971306 DCR KRYTI Raja Laundry-Dry Clean Jl.Ciliwung I No.2A Mlg 971299 DBTH LK/Pr Job Pabrik Taiwan Lembur %08515211211 Jl.Metro 7 Mlg 971317 ASY-SHA SPA Bth Wnt Max33 Therapis Spa Sift Pg/Mlm Htl Sahid Jl.Kahuripan 9 971330 DCRKRYWTIu/AuditIntrnMax30ThD3,S1. Akntnsi Ke PO.BOX 77 Mlg 65101 971409 CR IBU RT/Pnsiunan/Krywn U/Part Time 4Jam/hr BkrjdrRmh Incm.2-8Jt %08563568525 971532 DCR LULUSAN Smk Otomotif Jur.Mekanik Max23Th %485775 Jl.Ters.Borobudur 65 971647 DcrKryAhliDibid.Hard/SoftCover+Fotocopy. Gj.Mnrk.Krm ke:Sutami Printing,Jl.Bendun- gan Sutami 9C 971657 DICARI KAPSTERStaylist Lam Dj Salon Jl.D.Kerinci F 9C Kav 27 %085855924780 971656 BTH P/W Pt.Wootekh Indonesia Jl.Simp.Sul- fat Utr XI/22 Dtg Lgsg%082143327022 971698 KRJ SMPGN dRMH Nempel Tali Teh Upah 70rb/200Lb+Blnan PT HDN Ruko WOW A/10 Sawojajar Mlg H.ABIY 081949793377 971929 Dbthkn D Grafis Corel Psd Gaji Pkk+Bns, Krm Cv+Karya Ke Kedawung 1/1 Mlg 081703412004 971894 Dbthkn Tenaga Sablon Kaos Brpnglmn Borongan/Partime Kedawung 1/1 Mlg 081703412004 971890 KRJ PART TIME Ngelem Benang teh 1ktk @70rb+ komisi PT.HDN Ruko WOW Swojjar A10 Hub Hj.Miarsih 08125247912 971871 CRP/WKASIR,Bag.UmumUntukCab.Matos Batos,Bw Lmaran Ke:PBI K6/1 (ARAYA) 972039 DCARI SOPIR PRIBADI SOPIR SERABU- TAN MLG Jl.Galunggung 67 Hub:0341584295 972211 Cari Spv Sales,Sopir (B1/Umum),OB,Dom Mlg Srius Hub: Kauman 20 %0341-324384 972302 Dbthkan SGR:Marketing min.SMU+Teknik Sipil,Pglman Dibid-nya.Lmrn ditrma Tdk Lwt 1mgg ke:Jl.Candi Kalasan Blk IV/18 972368 BTH CPT! u/Ktr Cab.Br Di Mlg Pss:Staf (Adm,RCPT,GUD)Management(SPV,Ass men,Mngr)Syrt:Lls SMA/K-S1 Bs Bekerja Team Bw CV.Lgsg Ke PT.Mandiri Group Jl.Kol.Sugiono,Ruko Gadang Agency Kav. A5(Sebrang Pom Gadang) Pkl.10-14 972284 BTH PGW Toko,Wnt SLTA,Rajin,Jujur,Cktan. Omega Shoes.Trsn Borobudur 61 C 972256 DS-MAX Corps Lg Bthkn Tng Krj SPG/SPB 30org Crew Promo 15org,Gaji 300-500Rb.Dtg Lsg ke:Ruko Istana Dinoyo Blok D5,dpn McD Brawijaya.Up.Bp.Essa%089630402817 pin BB 21E76D99 972300 DCR TENAGA Serabutan Pria Pny Mtr+Sim C Max35Th Lam:Jl.Arif Margono 15A 972423 DICARI KARYAWATI Lulusan SMK/SMA Single Max24Th Lamaran Langsung Ke HK ELECTRONICS Jl.Kauman 19 MLG 972530 BTH SEGERAHRD,WEB DESIGN,KEPALA WARNET.Syrt:P/W Min.D3,Pngalaman DiBidangnya,Disiplin,BsTim.Lam:CV MITRA SEJAHTERA Jl.Terusan Kawi 6B MALANG 972543 DCR MODEL FOTO-EDITOR/Fotografer Cew- SPG-TelemarketingCew-PRT-%0817301405 972571 CR TNG KSAR SRBTN U/LuarKtaAdMESDtg PAGIKeGUDANGB2BlkgDepoBgunanKrglo 972568 BTH SGR LGSNG Interview U/ADM,GDG/OB, SPV,HRD P/W 18-56Th/Pensiun,Pglmn/Non SMSBiodataKe%085785472355ANANG(HRD) 972600 BTH CLEANING SERVICE(OB) Lam Dtg Lsng: PT.BINAMANDIRI Jl.Kartini No.1 MALANG 972644 BTH SEGERA u Home Industri Di CARUBAN MADIUN! Supervisor,Staff Produksi P/W,20- 27Th Lam:Jl.Kartini 1 Malang 972649 SABTU, 29 JUNI 2013 SURABAYA PUSAT KOST WWW.GRIYAMENTARI.COM KOS FasHtl Air PnsTvAc Mswi Grup03417678666/0341 7840999 971908 KOST PUTRI/Karyawati AC/Non AC Ka- mar Besar Citarum 1-B %7067 8907 972726 P RIA/KRYWN AC NON AC Jl.Cipunegara Dkt SUTOS/Jl.Mj.Sung- kono H.%5671994/08563312116 972321 RUMAH DIJUAL JUAL RMH diDaerah Ciliwung Panjang 22m Lebar 10m Luas 198m2 %081234547422 972960 RUMAH DIKONTRAKKAN DIKONT RMH Murah Jl.Gubeng Kertajaya 6 Langgar 25 Hub: Bu Ana %031-77085190 972359 RUKO DIKONTRAKKAN DKONT.RUKO2LtL:8x7Cocoku/Usaha,Dae- rah Tambaksari%5023173/0852.3000.1770 971575 STAND DIKONTRAKKAN JUAL/SEWA Jembatan Merah 2 Lt2A 34-35 StrgsHook%081332535733/087856667290 972267 SURABAYA TIMUR KOST TRM KOST Karyawan Pria,Kunci Sendiri ,TambakBening%72729162/081937888162 971343 Kost Pasutri,Kryw,Mhswa Rungkut Asri Brt dkt GIANT,MD %92112825 / 081135100 971349 P/W/SUTRIAC/NON/VIPFasLkpdktUNAIR/ ITS Jojoran1L/15%77823163/08123574167 971391 PAVILIUN/KOSTPutriBaik2 /Mhs/KrywKmd Dlm,AC Drh Ngagel %33413388/33413399 971923 KOST PUTRI/KRYWTI FasLkp,Kmd,Ac,Ex Fan Jl.Gunung Anyar Lor 54A%031-8705533 972689 RUMAH DIJUAL DIJUAL RUMAH di Pantai Mentari N-18 L:145M2 3KT Hub: 0817.0311.5996 971570 DIJUAL RUMAH di Pakuwon Sarento H2/20 L:120M2 4KT 2 Lantai Hub:0818595996 971572 DIJUAL RUMAH Sutorejo Tengah L=±175M2 2 Lantai 7KT Hub:0811372738 971574 J.Rmh SHM 2Lt Lt.85 Lb.170 Full Keramik. Jojoran Baru III/11 %08123448392 971748 J.RmhKost+FrniturkmdlmgrnitAChrsLaku mnggu ini bnting hrg 082147256447 971745 DIJUAL RUMAH Siap Huni Di Jl.Kertajaya Hub:%031-72388126 / 087853442387 971975 **DJLRMHJL.MANYARTIRTOMOYO2/12Uk. 266mHarga2.5MNego:0817338696Teguh 971891 PERUM GRIYA REG 400 UNIT SDH DIHUNI ANGS KPR HNYA 2jt.Dptkan PROMO UM DiAngs 10XDISC Slm pameran.fas lkp.ONE- GATE%34343232/70392277 971798 TAMAN GUNUNG Anyar T80/Bgs New 3Kt,1Km,Galvalum,Granit60x60plfon4m,Bn sCanopi,Pagar,tandon, HoreKota%70988519 972041 DIJUAL RUMAH Manyar Jaya VIII/51 Lt:162m2 ,Bang 2 Lantai Hub:%08155140052 972163 RAYWHITEKL,J.CptRmhMarinaMas,200m2 Strtgs, Murh,B.U. Tien Shu%70172708 972228 RMH Baru Asem Payung I/23 SHM LT132 3KM+3KT+1Mushola 625Jt Ng %31318388 972910 DIJUAL RUMAH Kapas Gading Madya 3-B Hrg.160JtNgPetokDUk:4x11Hub:88191319 972479 RUMAH DIKONTRAKKAN DIKONTRUMAHJl.Gubengjaya6/5CocokU/ Mahasiswa/Pgantin Baru%081332149297 972698 DIKONTRAKKANRUMAHDaerahRungkut4 KmTdr2KmMndiDekatMerr%03178360543 972495 DIKONT RMH Rungkut Harapan Blok D.10 Lt200m2 6Kt Grs 2Mbl 25Jt/Th %70974952 972936 DIKONT RMH Rungkut Tengah 13jt 2th Fas:1KT,KM,RT,dpr,jmrn72779972/83407228 972882 TANAH DIJUAL BUCPTTNHKav8x12Lok.MengantiAn.Sdri 30JtNego%083849767878/031-71433469 971857 TNH MDOKAN AYU8x15=200Jt,GAnyr 9x20 =220Jt10x20=130JtDll%77517060/70385489 971921 JUALTANAHUntukGudangdiGununganyar Uk:9x20 Hub: 70815453 / 081230292928 972433 TNH7x15:135JtUrugPAM10x20:215JtRy9x40 Gdg11x40GAnyarMdokanWRejo83220101 972713 J.TANAHSetroBaruXI/Kav.1819SHGBUk: 14x20 Hub:031-7716 2358/08121654821 972463 RUKO DIJUAL DJL Ruha Baru Jl.Wonorejo Sel I-A Rkt Lb.64M 2Kt,1Km %8793797 -087854222062 970235 DIJUAL RUKO JL KEDUNG COWEK NO.9 SHM Hub.MARTONO%0811341970/031-3815077TP 971731 SURABAYA SELATAN KOST KOSTPUTRIBgnBaruFasLkpParkirLuasSi- dosermoIndah I/7%8412144-08123005991 971543 RUMAH DIJUAL JUAL RMH KOST2AN 18Kmr Uk11x36 Kuti- sariSHMMblMasukHrg800JtNg%88264577 971601 J.RMH MURAH Lb78 Lt120 600JT MJD 550JT SHMS.HUNIDktALOHAIST%081231899985 971608 RMH DIJUAL 6x15 SHM Full Bang Tingkat Strategis Dkt Psr Juanda Desa Pranti Ada Yayasan TK %085731363630 971521 J.Rmh Full Bgnan SHM Renov Byangkara G2/9MasanganKln.08123083793/34195378 971789 J.RMHTingkat4kt+2km+PLN+PDAM=275jt Nego.BratangWetan4/16A%085331175306 971897 J.RMH Sepanjang Lt/B:120m2 Pam Tlp 3Km Garasi Bagus 50JtNego%085648823021 972081 RmhPgesanganAsri8/19,dktMsjdAl-Akbr tol,Lt207,Lb110 650jtng 087853922298 972103 SEDATI PERMAI T45 (7,5X10) %08151 5253505Foto( 971898 Dijual RUMAH BARU uk.8x10 Dekat Ban- dara Juanda. Hubungi: %0878 5274 7416 . 972146 RmhBrT406x10Prm.BhayangkaraPermai Sukodono 165Jt 70227848/081231607506 972298 JUAL RUMAH LT:440m2 LB:253m2 SHM 650jt Nego Siap Huni Hub:031-60951300 972489 JUAL RUMAH Lt.10x25 SHM Jl.Sikatan Gg Lebar No.15 %70126589 972915 RUMAH DIKONTRAKKAN RMH DELTASARI Indah N 112 6Kt 2Km Grsi Pln Pdam Tlp 4Ac 2Lt %081330173935 971633 DIKONT RMHJl.Jagir Sidoresmo Gg.VI/69 11jt/Tahun Uk:4x18m2 Hub:031-71916131 971765 RmhPCITamanLestariLux2LtT615/B550 5Ac Hook Bs.U/Ush-Kntr 50Jt 70667757 971813 TANAH DIJUAL TNHKAVS.BGNSHM-Skdono50JtnSsa7Unit DP5JtAngsTnpBng%70684651-77662471 971951 STAND DIJUAL J.STAND Terbuka/Tertutup Pasar Jl.Ry Dri- yorejo KM22 7jtan%81562132/77272167 972247 5jt Lsg Dagang Dipsr Grand Medaeng ready stock unit terbatas 081217697965/ 03171544797 972748 SURABAYA BARAT APARTEMEN DIJUAL APARTEMEN Puncak Permai 2BD tower A.%081944238055. 972974 KOST TERIMA KOS Fas Lengkap Pria/Wanita Jl.Jajar Tunggal Utara 4/F7%031-81244210 972422 RUMAH DIJUAL RUMAH Ls 10x20 P.tIRTOSARI 19/3 nETO 400Jt %5615693/81319686/081216317897 971502 BUNGARESIDENCEMENGANTINolJalanSiap HuniAgus%70749989;Ambrio%77956798 971700 J.RMH 6x12 HGB(90 jt) Wisma Sido Jang- kung P-32 Menganti,GRESIK%03170513278 971883 PrmSkrMliaRsd Mjsrirejo Dryorejo SHM MrhStrgs BbsBnjr 087751240049/70636775 971882 JUAL CPT RMHModernMinimalisSiapHuni Emerald 8/8 PPS Grsk H:03178031377 972555 DIJUAL RUMAH Manukan Loka 2.SHM 8 x 13. %081944238055 972976 J.CPTRMHSiapHuni7x12M,200JtNegoTan- jung Sari%081234594400/081252244453 972523 J.RMH Drh S.D.P.S 10x25 3KmrTdr,1KmrPmb antu,Garasi Tnp Prntara%087854555423 972693 RUMAH DIKONTRAKKAN DIKONTRMHTamanPondokIndahBlokAX- 7 Wiyung %031-77703631/081235959901 972094 TANAH DIJUAL J TNH SHM ANSNDR 6x16 JLN Pav Blk Psr Menganti/70jtng%71147139-087853266290 969069 J.MURAHTNHSHMP.80M,Lbr13,L.844,Lok. Pnggr jln Dkt Pbrk.TP.72096668/88230437 971866 KAV 7x20 Siap Bgn Hrg:55Jt Lok Selt Men- ganti Emas Hub:H.Sonhaji%71968395 971912 GUDANG J.Pbrk/Gdg Driyorejo dkt Sosro LT7000 LB4000 SHM 03131267178 , 081232954330 971742 TOKO DIKONTRAKKAN Dikont Toko Di Jl.Ry Lontar 5X10 Tinggal Pakai Murah 12,5Jt/Th 031-70712999 971833 MALANG APARTEMEN DKNTRKN APARTEMEN Soekarno Hatta Studio Murah %087859157345 972245 RUMAH DIJUAL *MULYOREJO RESIDENCE* Rmh Mewah Strgs Tgh Kota Free LED TV 200jtan UM1=5Jt One Gate 0341-2307685,2307672,2307686 970797 BULAN PROMO Rumah Baru Tipe 40 Ti- dar Kota Dekat Kampus Mall di Malang Hub:0341-7676456/08133381002 970796 D.Paniai 3 H4F 20,SHM,3Lt,Lt: 72m2 ,Lb: 165m2 ,5Kt,2Km,360jt/Ng %087859859041 970812 GRIYA BURING PERMAI DP5Jt BsJAM- SOSTEK/BAPERTARUM/UMUM H:Dodik %087859047289 970967 RMH PRM.Graha Dewata DD10 Lt150m Lb 90m3Kt2KmGrsiTmnShm%081937713656 971009 SAXOFONE RIVER Village T.40 45 Free Desain Lok.Strgs %9593110/085790949914 971035 SENGKALING RSDC T36/72 40/78 155Jt S.Huni%7695325/081331238335/081233 649225 971177 * GRIYA LANDUNGSARI *Tipe 36/72 Hrg. 175Jt.TUNAIDISKONBESAR%0341-9254433 971183 Dijual Cepat RumahPuriCempakaPutihN 21-22 Malang.HUB:085745972989NO SMS 971116 100m Dr Trmnl Arjsri Baru T45/90 Minmlis Bs Kpr Bns KSet 310jt%085234343566 971109 DKT TRMNAL Arjsri Siap Huni T70T125 Lt150 KSet Sofa 475jt%0857 5555 8333 971111 J.RUMAH Sktr Mentawai 1,25M 10x20 SHM Hub.Mentawai 1B %324766/085755040901 971325 JUALRMHBARUMinimlis9x12GriyaHusa- da Blok i-1/14 Sumber Porong Lawang 350Jt Nego %082230009170/03172567741 971524 KARANGPLOSO VIEW UM6Jtan(Bs BAPERTARUM ASABRI JAMSOSTEK) Angs KPR 500RbnFLAT%0341-7363685 /08563566880/ 0341-3149000 971578 RMH POJOK.S.HUNISWJRSHMLT155LB170 4KT2KM650JtNEGO%9796509/082338046699 971447 BU OMA VIEW Jln Utama 2Lt LT.135 3KT 2KM 1300W 300Jt %083 8484 39 298 971536 RMHPerumBumiPalapaDktKmps,Lt334m2 Lb250m2 1,5M Ng%7772773/081805062950 971489 RMH PRM.Muara Jetis Dau Dkt Umm3 Lt/Lb 90/110 3Kt1Km Grsi 325jt %081515382143 971649 DJL/SEWARmhRayaTumapelSgsriUtkKan- tor500Jt%081334426931/03412900718 971663 *KCLUSTER* Lok Jln Poros Dkt Kampus ,Psr,Angkot 24Jam,Bs Jmsostek,UM1 5Jt,Disk 10Jt Bns BBPagar%9555147/7772879 971665 *NEW MULYOREJO ASRI*Lok Dkt MOG, Dieng Plz,Kampus,Bs Jmsostk,UM1 5Jt,Disk 10Jt,Bonus BB,Hrg 150Jtan%9496064/8851 249/7770229 971669 RMH BRU Siap Huni Shm Pln Pdam Dkt Psr Perkantoran Prospek Bgs %08113604926 971683 NIRWANA PANDANWANGI Lok.Kwsn Sul- fatT.36/40/50Hrg.mulai215jtan%9606096 971792 MEWAH 240m2 5Kt+3KmJl.BratanDpnVelo- drom+PsrIndukNg%722020/085330602437 971824 JL RMHCptT45Lt135Lb1702LtKmt4Kmd2 Grsi SawojajarI%7753033/0816514072 971850 J.CPTRmhS.Huni6x15m130jtNgJl.Sonoten- gah RT63/13 Merpati23 Kbngng%9823753 972353 SONGSONGREGENCY45/78SHM145JtKPR DP Ringan %7588777/7737099/9733449 972388 RMH ETNA Arjosari Lt/Lb 150/70 Tnh Ls.330M Krebet Senggrong Tepi Jln Raya %0341-77 60 717 972263 BENDUNGAN PALASARI T.80 2Lantai Barat Kampus ITN % 93 999 57 972345 BELAKANG KAMPUS UIN T.40 80 2 Lan- tai % 93 999 57 / 081 233 651 657 972336 **PERMATA ROYAL Garden** Rmh Minimalis, Lok.Strategis,One Gate Sistem,UM 10jtan Bs Angsur 5x,T.3645,Disc.Menarik, Hrg.muali 150jtan %7724747/7771209/733 2720/8172748 972330 J.CPT RMH DiPandaan Ada Sarang Burung BekasTernak%087830769905/081216644879 972496 RAYWHITEDIENG%557878YUDHA%0817 9634504KaliurangLs.803/150CocokU/Usaha 972522 RMH LT170 LB110 Br Renov 4KT 1KM 2Lt Bareng Ry 2 Tgh Kota 500JtNg%085733333 887/9131377 972526 RMH OMAVIEW EB01LT193 LB113 KT5 KM2 350Jt%8666300/085755269757/0813 34887630 972551 PERUMPURITIRTAKrgloT36,50UangMuka Bisa DiAngs 6x%9200144/081234001258 972608 RMH BARU 9/15 STRGS 100m RAYA MLG-SBY Tumapel LandKav4 SGS RENOV %08125200965 972633 PERUM KOTA HRG MULAI 155Jt SHM,UM Diangsur10x%0341-7561968/085331065255 972643 TOKO2UNIT+RMHTngkat8KT(Gabung)Png- grJlnJalurAngktKodya750JtNG%7779928 972609 TANAH DIJUAL TNHKTKediri650Rb/m2JlnUdhAsplBlkng 521 Jl.A.Yani%03418621662 Tdk Sms 971324 JTNHKAVKrgplosoPnggrJln100m³UM25Jt 1,2x36Bln%085791112039/08113030559 971539 JUAL TANAH Kavling 6x11 Hrg.33jt Lok.Bu- miayu Kodya %7777172/081217137000 971506 TANAH DS.Karang Duren Luas ±196m2 Ajb Rp175rb/m Hub:0341-492632/9951788 971653 TANAH MURAH Jl.Pulau Batam 7 MLG Ls. 354m2 Hub:%0341-7006868/0811361787 971949 TNH TEGAL Miring di Pucang Songo-Pakis Ls.4200m2 Lebih,Isi Sengon Salomon Umur 2Th 500 Phn Hrg.70Jt %081333135880 972308 TNH KAV.Dkt PasarSDN Jeru I Ls.162m2 Hrg.45jt Ls.80m2 ada Bngn Kios Hrg.50jt %081333135880 972394 JUAL CPT Tnh Kbn Sawit Siap Panen 4Ha SHM Lok.Bnjrmasin Kalsel%081232783909 972222 TNH SWJJR II Poros Shm Dkt Kmps 9x30m 1,1jt/m Hub:081945392270/03419100264 972411 J.TANAH LT143m2 SHM BgnStandart D.Sema yang IV E2F/1 Swjr%364893/ 087759977279 972605 CPTTNHKAVGriyaShantaGEL360m2 SHM%0 81333391977,081553842022,087759607647 972538 TANAH DIKONTRAKKAN OPRKTRKTNH30x25CckU/UsahaTpiJlnRya Songsong(SblhPUSKESMAS)%081235115252 970984 DIKONT/J Tnh±1000m2 Ada Bgnan(5x15) 100m Dr Jl Ry Pakis 10Jt/Th%0341-5483232 971368 RUKO DIJUAL RUKAN CANDI TLAGAWANGI 2Lt+ Ground LT.4,5x22 LB.4,5x13%9796509/082 338046699 971443 DIJUALRUKO2LTDIKARANGLO LT135 LB150 SHM KPR%08123310483 971498 RUKO LT152 LB128SHM3KT,2KM(Shower Heater,ClosetDuduk)Garasi,TmpatCuciJemu ran,RT,RK,RM KotaBatu%0341-7565789 971474 RUKO DIKONTRAKKAN RUKOMEGASONGSONGCckBank/Ktr/Kraoke Ls271Gentong.RYSBY-MLG%081235115252 972022 TOKO DIKONTRAKKAN DIKONTRAKKAN TOKO daerah Bandulan TP Pinggir Jalan %7563932 971831 STAND DIJUAL RAYWHITE DIENG%557878 FREDY %08883456063 Matos LS6No35 Strategis DpnPujasera 971201 SIDOARJO RUMAH DIJUAL PERUMTulangan-SdaUM12Jt.FreeBPHTB Angg 800rbn Unit Terbatas H%88154513 968943 J.Rumah 7x15 Tambakrejo 43 Graha Men- tari Sda,Rmh diSby 10x20 Telp:70385489 971282 J.RMH 100jt 6x10 FulBgn Prm Primasari TeglnnCandiSDA%081216858165-71906774 971781 DIJUAL RUMAH KOST (10x30)M2 Ngaban Tanggulangin Telp:031-7033.7059 971787 Wahyu TamanSarirogoSda.FullRenov,36 SHM.175JtNego.%70764030-081233958665 971839 SAWO CANGKRING PERMAI UM 15jt. Angs1jtan.70872769-081554833803- 085859980388 971925 DJL RMH SHM L.569m2 HRG 800JT RY.BANDULAN 75/KEJAPANAN/GEMPOL %081330421399 972210 J.RMH CPT SidokareIndah F11 6x12 2Lt Ful- Bgn 300Ng%031-71906774-081216858165 972229 J.RMH PGG Lingkar Timur Buduran 7x13 S.Huni160jt%031-71906774-082132190100 972221 J.RMHS.HuniGting,GdganLT:7x40LtrC,Kt3, Km2,Crp2mbl, 310jtNg 031-91293251 972405 KAURIPAN NIRWANA AA5/12A 8X18m G. PsonaD1/79X153KT2KM081357917007J.Cpt 972346 RMH 10X15 MCG G2/5 SLT 4KT 2KM PAM TLP PLN AC GRS%087853735168/081703 299244 972313 u/USH pggr jlnRy10x10 fulbang 2lt Saman- hudi 8 Sda%085707040373-081904715101 972902 RMHPALEMNIRWANABuduranLt:112,3Kt Full Renov Cat Br 230jtNg%081265665856 972727 FLOWER KRIAN REGENCY Hunian Asri Harga Kompromi Hub:77956798/71880471/ 31393737/77160144 972524 J.RMH 5x15m DS: Terung Wetan Kec. Krian Sidoarjo 0821132246288/081231329298 972828 TANAH DIJUAL J.TNH Luas 3 HektarHrg475rb/M2 PetokD Lingkar Timur Sda BU %087854789320 971508 J.TANAH KAV SHM bs Diangsur 2thn Lok. Blkng Maspion 2 Buduran Sda %71151797 971860 KEDIRI Rumah Dijual Jl Letjend Suprapto II no 11 B Burengan Hub 082230830962 971286 DIJUAL TANAH Tepi Jalan Aspal Dekat Terminal Pare Lt8680m2 dan Kebon JatiSengon 4830m2 Berjarak 5m Harga Nego Hub:081334358122 971644 GRESIK DJL Perum KotaBaru DriyorejoGresik Jl.Batu Safir 8x15%081330750096-88153140 972684 J.TANAH 8x39 SHM 900rb/m2 di Jl.Gamping Pongangan Hub:0858 5290 3844 Grsk 972618 MOJOKERTO PURI ASRI UM 8Jt,Cicil 3x,Angs 18Rb/Hr 2Kmr Bersubsidi %0321-390963/6280179 969465 DJL CPT TNH Ls:2390M2 Jl.Ry Kebonagung Mjkt H:350rb/M2 Ng %081216050438 TP 971842 BLITAR JUAL/KONTRAK RUKO Jl.Veteran LT161 LB350CckUtkKantor/Toko%085655515929 971484 MADIUN Top Murah Tnh 575m2 @700Rb/m2 , SHM Jl SkolahanBanjarejoMadiun%085230966668 969354 TRAWAS BU.TNH±260m2 LokTamiaJengDktUbaya/ GrandTrawas H:85jtNg Hub:085732331562 971355 LAWANG RUMAHMINIMALIS2LtType90DktJlMLG- SBY Jl.Anjasmoro3B 350Jt%0341-2957779 970974 PANDAAN JCPTTANAHVilaLangitBiruRH100TheTa- man Dayu Pandaan NEGO%087759733434 972042 J.RMH Lt.231m2 Daerah Pandaan Jl.Suwayuwo Blok i-8 Hub:081703004035 972658 SURABAYA SELATAN RUMAH DIJUAL DIJUAL/DISEWAKAN MURAH KOS . . . . . . . ... . . . 1X25 . . . . . . . . 971015 TANAH DIJUAL TANAH . . . . . .. . . . . . . . .. . . . .1X25 971702 SURABAYA SELATAN RUMAH DIJUAL PERUM MPI MENGANTI . . . . . . . . . . . . . .1X40 ...... ... .. 971704 GRAHA ASRI SUKODONO . . . . . . . . . . . . . . . . ..1X25 972224 SURABAYA BARAT RUMAH DIJUAL OMA INDAH MENGANTI . . . . . . . . . . . . ..AUTO- PRO 971296 FOTO GREEN MENGANTI . . . . . . . . . .1X40 . . .......... 971711 SURABAYA BARAT RUMAH DIJUAL FOTO GREEN RIVER PARK . . . . . . . . . . . .1X40 .......... 971713 AGUNG . . . . . . . . . . . . . . . . . . . .1X25 972189 MALANG RUMAH DIJUAL RUMAH JL SUBALI . . . . .. . . . . . . . . . ..1X25 972172 SIDOARJO RUMAH DIJUAL GRAND ORIENTAL . . . . . . . . . . . . . . . .1X40 . . .......... 971696 SIDOARJO RUMAH DIJUAL HARMONI KOTA . . . . . . . . . . . . . . .1X40 . . . . ....... 971697 HARMONI KOTA KRIAN . . . . . . . . . . . . . . 1X40 ......... 971701 T30-70 PERUM MPI MENGANTI, CNR Wono- ayu, PMR Mojokerto UM Bisa Diatur 031- 70130618, 70634724, 085790763772 **PERUM GRAHA ASRI SUKODONO** T54 3KTUM:40jtbsdiangs10xpgrdpnblkg7083 3003,081553433003,8831898 mgg bk GREEN MENGANTI.Hunian Asri,Sby.Brt,One Gate,Strgs,Minimalis,Cash Back 5Jt+Hadiah Lsg,Jamsostek 031-71675257/34233363 OMA INDAH MENGANTI, Launching T.24 Kreatif, Angs Murah Bersubsidi, Jringn ListPDAM Hub: 031-5669555 , 34194942, 71378802, 77675659, 70894008 GREEN RIVER PARK.Strgs,Sby.Brt,One Gate, Minimalis,TembokKell,HunianAsri,CashBack 5Jt031-81521189/34805222/72062807 GOLDEN BERRY REGENCY Menganti Fas. Kolam Koi, Telaga Angsa, Taman Bermain, Galvalum, Parit Gorong2 Hub : 31385069 / 81458026 / 561614 GRAND ORIENTAL lok strtgs, one gate, mn- mlis modrn,UM1:5jt, bonus kitchen set, kom- portnm,tembokklltamanHub:72542600- 087857242229- 8924200 “ RUMAH BARU Siap Huni Jl.Subali Kav 15B/7 Swjjr2 LT200 LB70 3KT 2KM 550JtNego 5187077 / 081234001269 HARMONI KOTA SDA KOTA Ruha T50, T40, UM 5jt lok strgs, one gate, mnmlis mdrn, galvalum, R.stock, Hub:71855566- 087702922111 - 8924200 HARMONI KOTA KRIAN lok strtgs, nol jln, one gate, mnmls mdrn, UM 5jt, promo akhir bln cash back 15jt Hub: 77343391, 082331431043, 8924200 LOWONGAN KERJA Perusahaan Besar di JATIM, di Bidang RUBBER SAFETY L.P.G Membutuhkan Tenaga Kerja Untuk Posisi : - ADMINISTRASI - TECHNISI (MIN SMP) - MAINTENANCE - SUPERVISOR - KEPALA CABANG Pendapatan di Atas UMR, Mess, Tunjangan Transport, Ada Karier, Min SMU Sederajat Kirim Lamaran Langsung ke : 1.MALANG : JL TAMAN RADEN INTAN KAV 96 ARJOSARI 2.TULUNGAGUNG : JL JAYENG KUSUMA NO 27 NGUJANG 3.PASURUAN : JL R.A.KARTINI NO 18 LATEK-BANGIL 4.BOJONEGORO : JL PANGLIMA SUDIRMAN NO 92 5.MADIUN : RUKO CARUBAN INDAH JL PANGLIMA SUDIRMAN NO 34 CARUBAN 6.PONOROGO : JL YOS SUDARSO NO 60 JENES 7.BATU : JL DEWI SARTIKA IV NO 38 - BATU (Belakang BRI Pasar Batu) 8.BLITAR : JL RAYA PANDEAN NO 35 WLINGI TANPA DI PUNGUT BIAYA APAPUN DIBUTUHKAN SEGERA 1.MANAGER CABANG 2.ACCOUNTING 3.LOGISTIK 4.GUDANG 5.KURIR 6.CUST SERVICE PERSYARATAN : - Tidak Sedang Terikat Kerja - No 1- 3 ,Min S1 - No 4 ,Pria Min D3 - No 5 ,Pria Min SMA,Memiliki Mtr SIM C - No 6 ,Wanita Min SMA Lamaraan Kirim Ke : PT.LH SHOPPING Jl Puncak Indah Lontar No. 2 PTC-TT 06 Telp : 031-7392243 / 031-7392125
  • 26. Aremania SURYA/HAYU YUDHA PRABOWO CEDERA - Striker Greg Nwokolo berbincang dengan assis- ten pelatih Satia Bagja dalam latihan di stadion Gajayana Malang, Jumat (28/6). Greg diragukan untuk bisa tampil menghadapi Persija karena masih dalam proses penyem- buhan cedera. BERLATIH FINISHING - Striker Arema Cronous Alberto Goncalves menyundul bola dalam latihan di stadion Gajayana Malang, Jumat (28/6). Menjelang laga melawan Persija, Minggu (30/6) Arema mulai berlatih strategi dan finishing atau penyelesaian peluang di depan gawang. Kondisi Gathussy-Greg Masih Meragukan PELUANG bek Arema Cronous, Theirry Gathussi tampil menghadapi Persija Jakarta di Stadion Kanjuruhan, Minggu (30/6) sangat tipis. Gathussi masih berpacu dengan waktu untuk sembuh dari cedera. Dalam latihan di Stadion Gajayana, Jumat (28/6) pagi, pemain berusia 31 tahun ini absen. Pelatih Rahmad Darmawan mengaku sengaja mengistira- hatkan Gathussi sehari dan memilih menunggu kabar dari tim dokter soal cederanya. “Kalau dokter memberi lampu hijau, dia bisa gabung latihan,” kata RD. Jika Gathussi absen, RD sebenarnya tidak perlu khawa- tir. Stok pemain belakang cukup banyak, dan bisa mengisi posisi bek kiri yang dihuni Gathussy. Benny Wahyudi dan Jerico Cristiantoko bisa dimasukan untuk memperkuat lini belakang. Selain Gathussi, RD juga memikirkan pemain penganti untuk mengisi posisi yang mungkin ditinggalkan gelandang Greg Nwokolo. Pemain kelahiran Nigeria ini memang masih dalam proses penyembuhan cedera, dan peluangnya tam- pil masih fifty-fifty. Sebagai penganti Greg, RD telah menyiapkan Gede Su- kadana yang sejatinya juga baru sembuh dari cedera. Saat ditanya peluang Sukadana mengisi line up meng- gantikan Greg,RD belum bisa memastikannya. Menurutnya, tim pelatih harus memperhatikan banyak hal untuk ini. “Kedua, harus dilihat kebutuhan tim. kalau kita bermain dengan 4-3-3, berarti kan ada perubahan komposisi,” tam- bahnya. (jay) Janjikan Pesta Gol GRESIK, SURYA - Di putar- an pertama Liga Super Indone- sia (LSI) lalu, tuan rumah PSPS Pekanbaru menjungkalkan Persegres Gresik United de- ngan skor 2-0. KetikagiliranPersegresyang menjadi tuan rumah, Sabtu (29/6), maka targetnya sudah jelas. Menang! Persegres memiliki kesem- patan besar untuk membalas di Stadion Petrokimia Gresik karena kondisi PSPS yang ter- seok. PSPS terkubur di dasar klasemen sementara LSI atau peringkat 18, usai menelan em- pat kali kekalahan beruntun. Kekalahan pertama dimulai ketika digasak Persela Lamo- ngan dengan skor fantastis 9-1. Selanjutnya, PSPS babak belur dibekuk Persepam Madura United (MU) dengan skor 0-3. Tidak berhenti di sini, di dua laga home PSPS dipermalukan Persita Tangerang 0-5 dan di- tonjok Persib Bandung 0-4. Keterpurukan PSPS jadi pe- luang Persegres untuk menya- pu poin sempurna. Tetapi pelatih Widodo Cahyo- no Putro tidak peduli dengan track record PSPS yang menge- naskan di empat laga terakhir. Bagi Widodo, timnya hanya terfokus bagaimana bermain baik dan disiplin menjaga dae- rahpertahanan.Mengenaikeha- rusan menang dengan banyak gol (seperti yang dibukukan Persela), Widodo menyebutnya bukan target utama, meski jika itu terjadi akan sangat menye- nangkan Ultrasmania “Menang sebesar apa pun, sebuah tim tetap meraih tiga poin.Kamitidakmengincarke- menangan besar seperti lawan- lawan PSPS sebelumnya. Kami hanya mementingkan meraih poin sempurna dan bermain konsisten,” kata Widodo kepa- da Surya, Jumat (28/6). Menghadapi PSPS, Widodo menjanjikan permaian menye- rang. Serangan dari sektor sayap dan tengah lapangan akan menjadi andalan Widodo untuk mendobrak benteng pertahanan PSPS. “Kuncinya adalah ada di fi- nishing. Finishing para pemain harus bagus,” imbuh Widodo. (edr) WAJIB MENANG - Striker Persegres Ngon Mamoun (kanan) dituntut untuk menang besar atas PSPS Pekanbaru. | RD PANGGIL FANDI UNTUK TIMNAS U-23 Pelatih Timnas U-23, Rahmad Darmawan (RD), berencana memanggil gelandang Persela Lamo- ngan, Fandi Eko Utomo, bergabung Timnas Indonesia U-23. Tetapi, dipastikan nama Fandi tidak masuk dalam rombongan Timnas U-23 gelombang ketiga. RD mengungkapkan tim pelatih Timnas menyesuaikan pemanggilan pemain dengan jadwal kompetisi klub. Rencananya, pemain Timnas U-23 gelombang ketiga akan training center (TC) pada 11-15 Juli 2013. Padahal, Persela harus menantang Sriwijaya FC di Stadion Jakabiring Palembang, 11 Juli 2013. “Karena itu, kami menunda pemanggilannya. Kemungkinan dia masuk dalam rombongan selanjutnya,” kata RD kepada Surya, Jumat (28/6). RD juga menunda memanggil gelandang Sriwijaya FC, Ramdhani Lestaluhu. Setelah menjamu Laskar Joko Tingkir, Sriwijaya FC akan menjamu Persepam Pamekasan, 15 Juli 2013. (jay) HALAMAN 24 | | SABTU, 29 JUNI 2013 Hari Ini Persegres Jamu Tim Lemah PSPS■ PRAKIRAAN PEMAIN PERSEGRES: Hery Prasetya, Ambrizal, Sasa Zecevic, Erol Iba, Diogo Santos, Agus Indra, Siswanto, Ngon Mamoun, Shohei Matsunaga, Sultan Samma, Riski Novriansyah. PSPS: Adi Candra, Gusripen Effendi, Novi Hendrawan, Ario Putra, Dika Hanggara, Camara Namory, Hadison, Danil Junaidi, April Hadi, M Isnaini, Redo Rinaldi. MALANG, SURYA - Transisi pemain saat menyerang menjadi fokus utama pelatih Are- ma Cronous Rahmad Darmawan dalam per- siapan menghadapi Persija Jakarta, Minggu (30/6) besok. Menurut pelatih yang biasa disapa coach RD ini, transisi pemain Singo Edan saat mela- kukan serangan belum mulus. Pemain masih sering lambat menutup pos kosong yang ditinggalkan pemain yang berge- rak membantu serangan. Dia mencontohkan saat bek overlapping ke depan, seharusnya ada pemain yang mengisi posisi tersebut. “Mereka selalu lupa bahwa ada tugas lain ketika terjadi pemutasian posisi,” kata RD kepada Surya, Jumat (28/6). Saat latihan di Stadion Gajayana kemarin, RD terlihat cerewet memberikan instruksi tentang bagaimana pemain harus bergerak di- namis, khususnya dari posisi bertahan untuk kemudian menyerang. Porsi khusus ditujukan kepada pemain sa- yap, karena dari posisi inilah RD berharap se- rangan bisa mengalir deras jika serangan yang disusun dari tengah mentok dikaki pemain bertahan Persija. Selain itu, pelatih Timnas U-23 ini juga me- nitik beratkan latihan pada bagaimana menye- imbangkan zona pertahanan saat menghadapi serangan balik dari lawan. Menurutnya, pemain harus memahami tugasnya saat rekannya melaku- kan serangan atau pertahanan. “Jadi, antar pemain harus saling pengertian,” tambahnya. Beto Percaya Diri Sementara itu, striker Alberto ‘Beto’ Goncalves memastikan, seluruh tim sudah melupakan dua hasil seri dan kekalahan 1- 3 dari Sriwijaya FC lalu. Bagi pemain asal Brasil ini, fokus seluruh pemain tertuju pada Persija. Beto sendiri menyatakan keyakinannya jika Arema bisa bangkit di pertingan Ming- gu nanti dan menghasilkan tiga poin di hadapan Aremania. Selain persiapan yang dirasa sudah lebih dari cukup, kemenangan Arema 2-1 di putaran pertama 16 Februari 2013 membuat seluruh pemain ter- motivasi untuk mengulang sukses tersebut. “Kami akan berusaha menang di laga Minggu nanti. Kami ingin menyenangkan Aremania,” kata Beto. Mantan pemain Persipura Jayapura ini juga menyua- rakan keinginannya untuk bisa mencetak gol di per- tandingan nanti. (jay) MATANGKAN PERMAINAN RD Ingin Tim Tampil Menyerang■ Transisi SURYA/HAYU YUDHA PRABOWO SURYA/ERFAN HAZRANSYAH join follow @portalsurya
  • 27. MultisportHALAMAN 24 | | SABTU, 29 JUNI 2013 gresik, surya - Di putaran pertama Liga Super Indonesia (LSI) lalu, tuan rumah PSPS Pe- kanbaru menjungkalkan Per- segres Gresik United dengan skor 2-0. Ketika giliran Perse- gres yang menjadi tuan rumah, Sabtu (29/6), maka targetnya sudah jelas : menang! Persegres memiliki ke- sempatan besar untuk membalas di Stadion Petroki- mia Gresik. Dan kemenangan jadi harga mati bagi Laskar Joko Samudro. Kondisi PSPS yang terseok yang harus dimanfaatkan Sho- hei Matsunaga dkk. PSPS terkubur di dasar kla- semen sementara LSI atau pe- ringkat 18, usai menelan empat kali kekalahan beruntun. Kekalahan pertama dimulai ketika digasak Persela Lamo- ngan dengan skor fantastis 9-1. Selanjutnya, PSPS babak be- lur dibekuk Persepam Madura United (MU) dengan skor 0-3. Tidak berhenti di sini, di dua laga home PSPS diper- malukan Persita Tangerang 0-5 dan ditonjok Persib Ban- dung 0-4. Keterpurukan PSPS jadi ke- untungan Persegres untuk me- nyapu poin sempurna. Persegres justru terse- nyum usai menghantam tuan rumah Pelita Ban- dung Raya (PBR) 2-1. Moti- vasi para pemain Persegres terus dipoles pelatih Wido- do Cahyono Putro. Tetapi Widodo tidak pe- duli dengan track record PSPS yang mengenaskan di empat laga terakhir. Bagi Widodo, menang besar bukan target utama. Sebab yang terpenting adalah memetik poin sempur- na di hadapan Ultrasmania. “Menang sebesar apa pun, sebuah tim tetap meraih tiga poin. Kami tidak mengincar ke- menangan besar seperti lawan- lawan PSPS sebelumnya. Kami hanya mementingkan meraih poin sempurna dan bermain konsisten,” kata Widodo kepa- da Surya, Jumat (28/6). Menghadapi PSPS, Persegres dihadapkan pada pertemuan dengan mantan pemainnya yang kini membela PSPS. April Hadi yang memper- kuat Persegres di putaran per- tama, kemudian hengkang ke PSPS di putaran kedua. Tentunya ini akan menjadi sisi positif bagi PSPS karena salah satu pemainnya pernah memperkuat Persegres, ser- ta sedikit banyak mengetahui peta kekuatan Persegres. Terkait hal ini, Persegres akan tetap bermain sewajar- nya, sesuai ciri khas Persegres. Persegres akan bermain me- nyerang dari sektor sayap dan tengah lapangan. “Kuncinya adalah ada di finishing. Finishing para pemain harus bagus,” im- buh Widodo. (edr) Prioritas Persegres Tak Peduli Rekor Buruk PSPS■ asah serangan - Para pemain Arema berlatih, Jumat (28/6). Waswas sam- but Persija. surya/erfan hazransyah partai keras - Pemain futsal Surabaya (tengah) ditempel ketat dua pemain Sidoarjo pada pertandingan semifinal yang sengit di Rado Futsal Kota Madiun, Jumat (28/6). Sidoarjo lolos ke final, sudah dinanti Kota Madiun siang ini. Buru Sejarah Sepak Bola SIDOARJO memang hebat. Se- lain hampir mendekati status terbaik di cabang futsal, Tim Kota Udang juga tinggal selang- kah menjuarai sepak bola di Porprov Jatim IV/2013. Sidoarjo akan meladeni Ka- bupaten Malang pada final di Stadion Wilis, Sabtu (29/6). Kedua tim sama-sama menge- jar sejarah menjadi juara untuk kali pertama di arena dua ta- hunan itu. Pelatih Sidoarjo, Hariadi me- nuturkan, sukses menembus final merupakan prestasi terbaik di pentas Porprov. Perjalanan kami tidak berhenti di final. Kami akan terus berjuang keras untuk menang dan pulang membawa emas, tutur Hariadi, Jumat (28/6). Haridi mengaku, timnya siap menghadapi Kab Malang. Materi pemain yang dimiliki kedua tim dinilai berimbang dan berkuali- tas. Jadi siapa yang lebih siap, akan menjadi pememang. Saya berharap yang jadi pememang, tim kami, terang Hariadi. Sidoarjo melangkah ke partai puncak, menyusul kemenangan 1-0 atas Kabupaten Kediri pada babak semifinal, Kamis (27/6) malam. Gol tunggal Sidoarjo di- hasilkan Fathur Roni. Sementa- ra Kab Malang lolos ke final sete- lah menyisihkan juara bertahan Kota Kediri dengan 2-0. Dua gol diborong Dedik Setiawan. Pada final nanti, kami akan berjuang lebih keras. Target kami adalah emas, tegas Zamroni, pelatih Kabupaten Malang. (fat) tidak lengah - Striker Persegres, Bertrand Ngon Mamoun (kanan) men- dapat banyak kesempatan unjuk ketajam- an saat Aldo Barreto absen melawan PSPS Pekanbaru nanti. Persegres : Hery Prasetya, Ambrizal, Sasa Zecevic, Erol Iba, DiogoSantos,AgusIndra,Siswanto, Ngon Mamoun, Shohei Matsunaga, Sultan Samma, Riski Novriansyah. PSPS : Adi Candra, Gusripen Effendi,NoviHendrawan,ArioPutra, Dika Hanggara, Camara Namory, Hadison,DanilJunaidi,AprilHadi,M Isnaini, Redo Rinaldi. Prakiraan Pemain Sidoarjo di Ambang Juara Futsal Porprov 2013 madiun, surya - Rangkai- an ujian bagi kesiapan tim futsal Sidoarjo di cabang futsal pada Pekan olahraga Provinsi (Por- prov) Jatim IV/2013, mencapai fase tertinggi, Jumat (28/6). Pada semifinal yang meru- pakan big match di Rado Fut- sal Kota Madiun, Sidoarjo me- nyingkirkan tim kuat Surabaya 6-4 sekaligus memastikan tem- pat di final yang rencananya digelar Sabtu (29/6) siang. Dengan kemenangan atas Surabaya yang merupakan test-case terberat, Sidoarjo su- dah mendekati targetnya un- tuk juara. Syaratnya satu, yaitu mengalahkan tuan rumah Kota Madiun, yang menang 3-2 atas Kota Malang. PertemuanSidoarjolawanSu- rabaya, benar-benar panas, ketat dan menegangkan. Dua tim yang sejatinya 'pantas' bertemu di final, bermain ngotot dalam permainan tempo tinggi. Pertandingan kedua tim ber- jalan menarik. Maklum, baik Sidoarjo maupun Surabaya ber- materikan pemain-pemain yang ikut berkompetisi di Liga Fut- sal Amatir (LFA) Jatim. Sidoar- jo unggul lebih dahulu melalui lima gol hingga menit ke-18. Lima gol Sidoarjo dihasilkan Fathan Apriyanto di menit ke- tujuh, Adi Dwi P (9 dan 17) dan dua gol Fandi Hidayat (18). Tertinggal lima gol, Surabaya bermain agresif. Serangan gen- car terus dilakukan. Cara power play juga dipakai Surabaya. Usaha ini membuahkan ha- sil dengan dua gol yang dicep- loskan Alief Sutianto dan Debi yang sama-sama membobol ga- wang Sidoarjo di menit ke-19. Masuk babak kedua, Suraba- ya langsung menyengat. Baru berjalan dua menit atau menit ke-22, Gusti Dian membobol Si- doarjo guna membawa skor 3-5. Surabaya kian bernafsu me- nambah gol. Surabaya terus me- nekan dan mengurung gawang Sidoarjo. Sebaliknya Sidoarjo le- bih banyak bertahan dan meng- andalkan serangan balik. Pertandingan babak kedua berlangsung sengit, ketat dan kerap terjadi benturan fisik. Surabaya sesekali bermain ke- ras ketika kehilangan bola. Ka- rena permainan menjurus kasar, Sidoarjo sempat mogok guna memprotes wasit. Surabaya sempat menempel Sidoarjo, menyusul gol Abdul- lah di menit ke-31 untuk mem- bawa skor 4-5. Terlalu bernafsu menyerang, Surabaya menjadi lengah. Sidoarjo melalui Fathan Apriyanto mem- buat gol jarak jauh ketika Surabaya tidak menggunakan kiper. Sidoarjo punmenguburSurabaya6-4. Kami sangat bersyukur atas ke- menangan ini dan tampil di final. Saya akui, lawan Surabaya ini me- rupakan yang terberat, selain Gre- sik,sebutRuliantyo,asistenpelatih Sidoarjousailaga,Jumat(28/6). Ia mengakui pemainnya sem- pat terpancing permainan keras Surabaya. Tetapi, pemain bisa mengatasi, jelas Rulianto. Pelatih Surabaya, Hadi 'Iwan' Purwanto memakai skema power play. Tetapi timnya justru keco- longan. Anak-anak masih gu- gup bermain power play. Padahal kami tampil lebih menyerang. Sidoarjo banyak menunggu, se- hingga kami sulit menembus, beber Hadi. (fat) Fandi Masuk Proyeksi Timnas U-23 malang, surya - Sepak terjang Fandi Eko Utomo ber- sama Persela Lamongan mulai mendapat pengakuan. Dan itu datang dari pelatih sekaliber Rahmad Darmawan (RD). RD yang juga menangani Timnas U-23, berencana me- manggil gelandang muda Per- sela itu untuk bergabung di Skuad Garuda Muda. Tetapi di- pastikan nama Fandi tidak ma- suk dalam rombongan Timnas U-23 gelombang ketiga. RD mengungkapkan tim pelatih Timnas menyesuaikan pemanggilan pe- main dengan jadwal kom- petisi klub. Rencananya Timnas U-23 gelombang ketiga akan melakukan training center (TC) pada 11-15 Juli. Padahal Persela menantang Sriwijaya FC di Stadion Jaka- biring, 11 Juli. Sehingga sangat terbatas waktu bagi Fandi un- tuk langsung ke Timnas U-23. Pemain yang juga anak dari mantan pemain Persebaya, Yu- suf Ekodono ini harus masuk gelombang keempat. “Makanya kami menunda pemanggilannya. Kemungkin- an Fandi masuk dalam rom- bongan selanjutnya,” kata RD kepada Surya, Jumat (28/6). RD juga menunda me- manggil gelandang Sriwijaya FC, Ramdhani Lestaluhu. Se- telah menjamu Laskar Joko Ting- kir, Sriwijaya FC akan menjamu Persepam MU, 15 Juli. Pemanggilan pemain Tim- nas U-23 gelombang ketiga ini untuk menghadapi jamuan Timnas Singapura. Sesuai jad- wal, laga tandang ke Singapu- ra akan digelar 15 Juli. Pemain baru dikembalikan ke klub- nya,16 Juli. Lima pemain Arema Cro- nous akan bergabung ge- lombang ketiga ini. Yaitu Egi Melgiansyah, Kurnia Meiga, Sunarto, Dendi Santoso dan Hendro Siswanto. (jay) surya/erfan hazransyah hampir double - Pemain sepak bola Sidoarjo (15) dihadang pemain Kab Kediri di semifinal. Ingin buru gelar ganda bersama futsal. Arema Belum Maksimal arema, surya - Arema Cronous akan memaksimalkan serangan dalam laga kontra Persija Jakarta LSI di Stadion Kan- juruhan, Minggu (30/6). Pelatih Arema, Rahmad Darmawan (RD) memberi catat- an untuk pola serangan anak asuhnya. Dalam latihan di Stadion Gajayana, Jumat (28/6) pagi, RD memanaskan serangan tim. Bukan hanya penyerang, pemain bertahan dan sayap pun mendapat perhatian. Serangan bisa dilakukan pemain dari posisi mana pun. Bah- kan pemain belakang pun bisa menjebol perta- hanan lawan. RD menilai pemain sering lupa tandem-nya saat melakukan serangan. Dia mencontohkan saat bek melakukan overlapping, seharusnya ada pemain yang me- nutupi posisi tersebut. “Mereka lupa bahwa ada tugas lain ketika terjadi transisi,” kata RD kepada Surya. Pelatih Timnas U-23 ini mengemu- kakan tujuan latihan ini adalah untuk menyeimbangkan zona pertahanan. Bila tim lawan melakukan serangan balik, pertahanan Tim Singo Edan tetap kokoh dan ti- dak mudah dijebol. RD juga menekankan ketenangan dalam finishing. Menurutnya, Alberto ‘Beto’ Gon- calves dkk belum belum bisa tenang dalam finishing. Dalam small game, kedua tim sama- sama memiliki peluang lebih dari lima kali. Tetapi hanya sedikit gol yang dicetak. “Pe- main harus bisa memaksimal pelu- ang. Itu yang nomor satu,” terang RD. (jay) surya/erfan hazransyah fandi eko utomo (persela) TIGAPOIN surya/hayu yudha prabowo perolehan medali porprov, jumat (28/06) Sampai Pkl. 16.45 WIB 1.Surabaya 81 78 58 2.Kota Kediri 35 27 16 3.Kota Malang 27 17 25 4.Kab Malang 20 20 43 5.Gresik 24 16 19 6.Sidoarjo 17 18 32 7.Lamongan 11 12 9 8.Kota Blitar 9 12 13 9.Kota Pasuruan 8 9 11 10.Banyuwangi 5 10 9 surya/erfan hazransyah join follow @portalsurya
