SlideShare una empresa de Scribd logo
1 de 30
Development of Biomarkers for Stress in Octopus Rachel Thompson School of Aquatic and Fishery Sciences May 15, 2009
Background ,[object Object],[object Object],[object Object],[object Object],Giant Pacific Octopus ( E. dofleini ) Red Octopus ( O. rubescens )
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Non-Invasive Techniques ,[object Object],[object Object],[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Protein Gel Electrophoresis ,[object Object],[object Object],[object Object],[object Object],Container Underwater Skin
Protein Identification ,[object Object],[object Object]
Mass Spectroscopy ,[object Object],[object Object],[object Object],Description Sequence (P02662) Alpha-S1-casein precursor YLGYLEQ (P02662) Alpha-S1-casein precursor EPMIGVNQELAYFYPELFR (P02808) Statherin precursor RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF (P81605) Dermicidin precursor [Contains: Survival-promoting peptide; DCD-1] DAVEDLESVGK
Proteins Isolated from Mucus ,[object Object],[object Object],[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Heat Shock Proteins ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Western Blot - HSP 70 ,[object Object],[object Object],[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Behavior Monitoring   ,[object Object],[object Object],[object Object],Cephcam watch ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Behavior Observations ,[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Egg Development Laid January, 2009 Refrain from imposing stressful conditions
Observation of Developmental Stages Early: 8 weeks
Late: 12 weeks - Appearance of  chromatophores - Movement within egg
 
Egg Development ,[object Object],[object Object],[object Object],[object Object]
Developmental Genes ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Real-Time PCR (qPCR) ,[object Object],[object Object],[object Object]
Orthodenticle-like protein (OTX) -Expressed early in development  -100,000 fold increase over time
Hedgehog (Hh) -Expressed later in development <100 fold increase over time
Results-Gene Expression ,[object Object],[object Object],[object Object],[object Object],[object Object]
Behavior Observations Prior to Egg-Laying Post Egg-Laying
Summary ,[object Object],[object Object],[object Object],[object Object]
Applications and Future Work ,[object Object],[object Object],[object Object]
Acknowledgements ,[object Object],[object Object],[object Object],[object Object]

Más contenido relacionado

La actualidad más candente

13 4 applications of genetic engineering
13 4 applications of genetic engineering13 4 applications of genetic engineering
13 4 applications of genetic engineeringarislantern
 
Genetics By Swati & Sheela
Genetics By Swati & SheelaGenetics By Swati & Sheela
Genetics By Swati & Sheelasubzero64
 
Transgenic animal prof.a.k.saha
Transgenic animal prof.a.k.sahaTransgenic animal prof.a.k.saha
Transgenic animal prof.a.k.sahaAnanda Saha
 
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...Larry Smarr
 
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and MetagenomicsCross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics Christopher Mason
 
2 chapter 5 genes and chromosome
2 chapter 5   genes and chromosome2 chapter 5   genes and chromosome
2 chapter 5 genes and chromosomea alice
 
Epigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune ResponseEpigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune Responsesr320
 
Transgenic animal models &amp; their
Transgenic animal models &amp; theirTransgenic animal models &amp; their
Transgenic animal models &amp; theirkalpanatiwari17
 
Genetic Engineering Powerpoint
Genetic Engineering PowerpointGenetic Engineering Powerpoint
Genetic Engineering PowerpointMrG
 
Genetic engineering oral
Genetic engineering oralGenetic engineering oral
Genetic engineering oralDamien512
 
Genetic engineering in animal
Genetic engineering in animalGenetic engineering in animal
Genetic engineering in animalTaikiat Kiat
 
Genetic engineerig
Genetic engineerigGenetic engineerig
Genetic engineerigUsman Arshad
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineeringguestb995763
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic EngineeringDamien512
 
Biotechnology and1 genetic engineering
Biotechnology and1 genetic engineeringBiotechnology and1 genetic engineering
Biotechnology and1 genetic engineeringmandalina landy
 
Nanopore long-read metagenomics
Nanopore long-read metagenomicsNanopore long-read metagenomics
Nanopore long-read metagenomicsMartin Hölzer
 

La actualidad más candente (20)

13 4 applications of genetic engineering
13 4 applications of genetic engineering13 4 applications of genetic engineering
13 4 applications of genetic engineering
 
Genetics By Swati & Sheela
Genetics By Swati & SheelaGenetics By Swati & Sheela
Genetics By Swati & Sheela
 
Genetic Engineering ppt
Genetic Engineering pptGenetic Engineering ppt
Genetic Engineering ppt
 
Transgenic animal prof.a.k.saha
Transgenic animal prof.a.k.sahaTransgenic animal prof.a.k.saha
Transgenic animal prof.a.k.saha
 
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
 
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and MetagenomicsCross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
 
2 chapter 5 genes and chromosome
2 chapter 5   genes and chromosome2 chapter 5   genes and chromosome
2 chapter 5 genes and chromosome
 
Epigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune ResponseEpigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune Response
 
Future of technology
Future of technologyFuture of technology
Future of technology
 
Transgenic animal models &amp; their
Transgenic animal models &amp; theirTransgenic animal models &amp; their
Transgenic animal models &amp; their
 
Genetic Engineering Powerpoint
Genetic Engineering PowerpointGenetic Engineering Powerpoint
Genetic Engineering Powerpoint
 
Genetic engineering oral
Genetic engineering oralGenetic engineering oral
Genetic engineering oral
 
Transgenic animals
Transgenic animalsTransgenic animals
Transgenic animals
 
Genetic engineering in animal
Genetic engineering in animalGenetic engineering in animal
Genetic engineering in animal
 
Genetic engineerig
Genetic engineerigGenetic engineerig
Genetic engineerig
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineering
 
Transgenic Talk
Transgenic TalkTransgenic Talk
Transgenic Talk
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineering
 
Biotechnology and1 genetic engineering
Biotechnology and1 genetic engineeringBiotechnology and1 genetic engineering
Biotechnology and1 genetic engineering
 
Nanopore long-read metagenomics
Nanopore long-read metagenomicsNanopore long-read metagenomics
Nanopore long-read metagenomics
 

Similar a Thompson_MGpresentation

Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011 Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011 changingconnections
 
Rebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote SlidesRebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote SlidesRJ Stangherlin
 
General biology-2-module-1-answers
General biology-2-module-1-answersGeneral biology-2-module-1-answers
General biology-2-module-1-answersSherylOsorio
 
Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship ApplicationJonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship ApplicationJon Lendrum
 
screening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptxscreening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptxAHEMANTHBABU
 
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat:  Understanding Continuous, Real Time Physiologic MonitoringDon't Miss a Beat:  Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic MonitoringInsideScientific
 
Lecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.pptLecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.pptKelechiChukwuemeka
 
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...Healthcare and Medical Sciences
 
Genetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosisGenetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosisTijani Hamzat Ibiyeye
 

Similar a Thompson_MGpresentation (20)

Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011 Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
 
Rebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote SlidesRebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote Slides
 
General biology-2-module-1-answers
General biology-2-module-1-answersGeneral biology-2-module-1-answers
General biology-2-module-1-answers
 
Host Cell Proteins
Host Cell ProteinsHost Cell Proteins
Host Cell Proteins
 
Host Cell Proteins
Host Cell ProteinsHost Cell Proteins
Host Cell Proteins
 
Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship ApplicationJonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
 
Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...
Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...
Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...
 
screening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptxscreening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptx
 
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat:  Understanding Continuous, Real Time Physiologic MonitoringDon't Miss a Beat:  Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
 
Lecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.pptLecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.ppt
 
Poster
PosterPoster
Poster
 
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
 
Genetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosisGenetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosis
 
Biotechnology.pptx
Biotechnology.pptxBiotechnology.pptx
Biotechnology.pptx
 
Galvao MOL et al 2009
Galvao MOL et al 2009Galvao MOL et al 2009
Galvao MOL et al 2009
 
Galvao MOL et al 2009
Galvao MOL et al 2009Galvao MOL et al 2009
Galvao MOL et al 2009
 
Npy
NpyNpy
Npy
 
Npy final paper
Npy final paperNpy final paper
Npy final paper
 
Npy final paper
Npy final paperNpy final paper
Npy final paper
 
Varney_2015
Varney_2015Varney_2015
Varney_2015
 

Más de sr320

Identifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for RestorationIdentifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for Restorationsr320
 
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?sr320
 
Science Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's PerspectiveScience Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's Perspectivesr320
 
Genomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem healthGenomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem healthsr320
 
Collaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the CloudCollaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the Cloudsr320
 
Genomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more OpenGenomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more Opensr320
 
NSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome ResourcesNSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome Resourcessr320
 
Short read sequencing and shellfish
Short read sequencing and shellfishShort read sequencing and shellfish
Short read sequencing and shellfishsr320
 
FISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylationFISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylationsr320
 
FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression sr320
 
FISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimationFISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimationsr320
 
Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011sr320
 
Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11 Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11 sr320
 
FISH510 Lec 1
FISH510 Lec 1FISH510 Lec 1
FISH510 Lec 1sr320
 
FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)sr320
 
Timmins-Schiffman P2010
Timmins-Schiffman P2010Timmins-Schiffman P2010
Timmins-Schiffman P2010sr320
 
Gavery PCSGA 2010
Gavery PCSGA 2010Gavery PCSGA 2010
Gavery PCSGA 2010sr320
 
Salmon Senescence
Salmon SenescenceSalmon Senescence
Salmon Senescencesr320
 
Roberts GRC
Roberts GRCRoberts GRC
Roberts GRCsr320
 
Herring SNP Sneak Peak
Herring SNP Sneak PeakHerring SNP Sneak Peak
Herring SNP Sneak Peaksr320
 

Más de sr320 (20)

Identifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for RestorationIdentifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for Restoration
 
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
 
Science Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's PerspectiveScience Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's Perspective
 
Genomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem healthGenomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem health
 
Collaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the CloudCollaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the Cloud
 
Genomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more OpenGenomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more Open
 
NSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome ResourcesNSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome Resources
 
Short read sequencing and shellfish
Short read sequencing and shellfishShort read sequencing and shellfish
Short read sequencing and shellfish
 
FISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylationFISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylation
 
FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression
 
FISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimationFISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimation
 
Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011
 
Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11 Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11
 
FISH510 Lec 1
FISH510 Lec 1FISH510 Lec 1
FISH510 Lec 1
 
FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)
 
Timmins-Schiffman P2010
Timmins-Schiffman P2010Timmins-Schiffman P2010
Timmins-Schiffman P2010
 
Gavery PCSGA 2010
Gavery PCSGA 2010Gavery PCSGA 2010
Gavery PCSGA 2010
 
Salmon Senescence
Salmon SenescenceSalmon Senescence
Salmon Senescence
 
Roberts GRC
Roberts GRCRoberts GRC
Roberts GRC
 
Herring SNP Sneak Peak
Herring SNP Sneak PeakHerring SNP Sneak Peak
Herring SNP Sneak Peak
 

Último

Separation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesSeparation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesFatimaKhan178732
 
CARE OF CHILD IN INCUBATOR..........pptx
CARE OF CHILD IN INCUBATOR..........pptxCARE OF CHILD IN INCUBATOR..........pptx
CARE OF CHILD IN INCUBATOR..........pptxGaneshChakor2
 
Hybridoma Technology ( Production , Purification , and Application )
Hybridoma Technology  ( Production , Purification , and Application  ) Hybridoma Technology  ( Production , Purification , and Application  )
Hybridoma Technology ( Production , Purification , and Application ) Sakshi Ghasle
 
APM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across SectorsAPM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across SectorsAssociation for Project Management
 
Accessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impactAccessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impactdawncurless
 
URLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website AppURLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website AppCeline George
 
Solving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptxSolving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptxOH TEIK BIN
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introductionMaksud Ahmed
 
How to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxHow to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxmanuelaromero2013
 
“Oh GOSH! Reflecting on Hackteria's Collaborative Practices in a Global Do-It...
“Oh GOSH! Reflecting on Hackteria's Collaborative Practices in a Global Do-It...“Oh GOSH! Reflecting on Hackteria's Collaborative Practices in a Global Do-It...
“Oh GOSH! Reflecting on Hackteria's Collaborative Practices in a Global Do-It...Marc Dusseiller Dusjagr
 
Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)eniolaolutunde
 
PSYCHIATRIC History collection FORMAT.pptx
PSYCHIATRIC   History collection FORMAT.pptxPSYCHIATRIC   History collection FORMAT.pptx
PSYCHIATRIC History collection FORMAT.pptxPoojaSen20
 
Presiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsPresiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsanshu789521
 
Crayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon ACrayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon AUnboundStockton
 
Mastering the Unannounced Regulatory Inspection
Mastering the Unannounced Regulatory InspectionMastering the Unannounced Regulatory Inspection
Mastering the Unannounced Regulatory InspectionSafetyChain Software
 
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17Celine George
 
The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13Steve Thomason
 
Call Girls in Dwarka Mor Delhi Contact Us 9654467111
Call Girls in Dwarka Mor Delhi Contact Us 9654467111Call Girls in Dwarka Mor Delhi Contact Us 9654467111
Call Girls in Dwarka Mor Delhi Contact Us 9654467111Sapana Sha
 

Último (20)

Separation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesSeparation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and Actinides
 
CARE OF CHILD IN INCUBATOR..........pptx
CARE OF CHILD IN INCUBATOR..........pptxCARE OF CHILD IN INCUBATOR..........pptx
CARE OF CHILD IN INCUBATOR..........pptx
 
Hybridoma Technology ( Production , Purification , and Application )
Hybridoma Technology  ( Production , Purification , and Application  ) Hybridoma Technology  ( Production , Purification , and Application  )
Hybridoma Technology ( Production , Purification , and Application )
 
APM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across SectorsAPM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across Sectors
 
Accessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impactAccessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impact
 
TataKelola dan KamSiber Kecerdasan Buatan v022.pdf
TataKelola dan KamSiber Kecerdasan Buatan v022.pdfTataKelola dan KamSiber Kecerdasan Buatan v022.pdf
TataKelola dan KamSiber Kecerdasan Buatan v022.pdf
 
URLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website AppURLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website App
 
Solving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptxSolving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptx
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introduction
 
Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝
 
How to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxHow to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptx
 
“Oh GOSH! Reflecting on Hackteria's Collaborative Practices in a Global Do-It...
“Oh GOSH! Reflecting on Hackteria's Collaborative Practices in a Global Do-It...“Oh GOSH! Reflecting on Hackteria's Collaborative Practices in a Global Do-It...
“Oh GOSH! Reflecting on Hackteria's Collaborative Practices in a Global Do-It...
 
Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)
 
PSYCHIATRIC History collection FORMAT.pptx
PSYCHIATRIC   History collection FORMAT.pptxPSYCHIATRIC   History collection FORMAT.pptx
PSYCHIATRIC History collection FORMAT.pptx
 
Presiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsPresiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha elections
 
Crayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon ACrayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon A
 
Mastering the Unannounced Regulatory Inspection
Mastering the Unannounced Regulatory InspectionMastering the Unannounced Regulatory Inspection
Mastering the Unannounced Regulatory Inspection
 
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
 
The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13
 
Call Girls in Dwarka Mor Delhi Contact Us 9654467111
Call Girls in Dwarka Mor Delhi Contact Us 9654467111Call Girls in Dwarka Mor Delhi Contact Us 9654467111
Call Girls in Dwarka Mor Delhi Contact Us 9654467111
 

Thompson_MGpresentation