SlideShare a Scribd company logo
1 of 3
Dear students get fully solved assignments by professionals
Send your semester & Specialization name to our mail id :
stuffstudy5@gmail.com
or
call us at : 098153-33456
(Prefer mailing. Call in emergency )
ASSIGNMENT
DRIVE FALL 2015
PROGRAM MBADS – (SEM 4/SEM 6) MBAN2 / MBAFLEX – (SEM 4)
PGDROMN– (SEM 2)
SUBJECT CODE & NAME ML0016- Advertising Management and Sales Promotion
SEMESTER 4
BK ID B1809
CREDITS 4
MARKS 60
Note: Answer all questions. Kindly note that answers for 10 marks questions should be
approximately of 400 words. Each question is followed by evaluation scheme.
1. Explain the different types of Advertising copy.
Answer: Classification of Advertisement Copy
It is true that copy writing is an art and the copywriter has a very important role to play in
advertising creativity. Copy writing does not admit any stereotyped rules and classification. There
are various styles in which a copy can be prepared and presented. The following classification of
advertisement copy may be studied;
1. Descriptive Copy– Thistype of copy describesthe pertinentandrelevant characteristics features
of the product. It is very simple and of non- technical nature. It does not have any specialty which
can attract the attention of the target consumers or may compel them to read it. It is very much
similartoa pressaccount or newsitemsimplygivingrelevantinformation to the public without any
stylish touch.
2. Scientific Copy – Such types of copies are technical in nature and generally used by drugs and
pharmaceutical firmselaboratingthe propositions of properties and constituents of the product. It
provides full information about the product and
2. Discussthe DAGMAR approach insetting objectivesandmeasuringeffectiveness of advertising.
Answer : Meaning of DAGMAR approach
Advertising is a part of marketing sometimes avoided by small business as it can be perceived as
costly, ineffective and only appropriate for large corporations. However an understanding of
advertising models such as AIDA and DAGMAR can help any small business plan more effective
advertising.
AIDA standsfor Attention,Interest, Desire and Action and can be used in small business marketing
to improve campaigns, including those based on email autoresponders.
DAGMAR (Defining Advertising Goals for Measured Advertising Results) is much more than a
model for designing an advert, it is used to monitor a
3. Advertising is a paid form of communication. It has gained its significance since it attempts to
build a positive attitude towards a product. Explain the characteristics and objectives of
advertising.
Answer : Three Main Advertising Objectives
Increasing Sales and Profits
One of the major objectives of advertising is to increase sales and profits. Some companies, like
Internetbusinesses,onlyuse advertisingtoapprise people abouttheir products and services. These
companiesdon'thave salesdepartments.Hence,theycanonlysell products and earn profits if they
are activelyadvertising.Some forms of advertising lend themselves more to producing immediate
profits. For example, direct response advertising
4 What is “above the line” and “below the line” activities with respect to marketing
communications? Explain the concept in detail.
Answer : Above-the-line
There are a number of approaches to promotion that are open to organisations. Above-the-line
promotions use mass media methods. This type of promotion focuses on advertising to a large
audience. It includes print, online media, television and cinema advertising.
As the fourth largest car company in the world, Kia is a big brand. It offers a range of products
targeted at different market segments.kia-piccanto Above-
5 Describe the AIDA model of consumer response hierarchy with the help of diagram.
Answer:The Hierarchyof EffectsModel was createdin1961 by RobertJ Lavidge andGary A Steiner.
This marketing communication model, suggests that there are six steps from viewing a product
advertisement(advert) toproductpurchase.The jobof the advertiser is to encourage the customer
to go through the six steps and purchase the product.
Hierarchy Of Effects Model
6. Describe some of the strategies for effective marketing and advertising in rural market.
Answer : In order to utilize the immense potential in rural markets companies need to develop
specific marketing mix and action plans, taking into consideration the complex set of factors that
influenceconsumerbehaviour. Innovative companies which adopted an integrated approach have
succeeded in utilizing marketing opportunities that rural areas offer.
Different rural marketing strategies in India
1. Competitive strategy
1.1. Supplier:The company not onlyhas to make highqualityproductsbutalso has to sell them
cheap. This can be achieved only if the
Dear students get fully solved assignments by professionals
Send your semester & Specialization name to our mail id :
stuffstudy5@gmail.com
or
call us at : 098153-33456
(Prefer mailing. Call in emergency )

More Related Content

Recently uploaded

The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptx
heathfieldcps1
 
Activity 01 - Artificial Culture (1).pdf
Activity 01 - Artificial Culture (1).pdfActivity 01 - Artificial Culture (1).pdf
Activity 01 - Artificial Culture (1).pdf
ciinovamais
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptx
heathfieldcps1
 
Making and Justifying Mathematical Decisions.pdf
Making and Justifying Mathematical Decisions.pdfMaking and Justifying Mathematical Decisions.pdf
Making and Justifying Mathematical Decisions.pdf
Chris Hunter
 

Recently uploaded (20)

Class 11th Physics NEET formula sheet pdf
Class 11th Physics NEET formula sheet pdfClass 11th Physics NEET formula sheet pdf
Class 11th Physics NEET formula sheet pdf
 
Asian American Pacific Islander Month DDSD 2024.pptx
Asian American Pacific Islander Month DDSD 2024.pptxAsian American Pacific Islander Month DDSD 2024.pptx
Asian American Pacific Islander Month DDSD 2024.pptx
 
Measures of Dispersion and Variability: Range, QD, AD and SD
Measures of Dispersion and Variability: Range, QD, AD and SDMeasures of Dispersion and Variability: Range, QD, AD and SD
Measures of Dispersion and Variability: Range, QD, AD and SD
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
 
The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptx
 
Sociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning ExhibitSociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning Exhibit
 
Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024
 
Z Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot GraphZ Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot Graph
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
 
Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...
Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...
Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptx
 
General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual  Proper...General Principles of Intellectual Property: Concepts of Intellectual  Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...
 
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
 
Activity 01 - Artificial Culture (1).pdf
Activity 01 - Artificial Culture (1).pdfActivity 01 - Artificial Culture (1).pdf
Activity 01 - Artificial Culture (1).pdf
 
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptxINDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptx
 
Nutritional Needs Presentation - HLTH 104
Nutritional Needs Presentation - HLTH 104Nutritional Needs Presentation - HLTH 104
Nutritional Needs Presentation - HLTH 104
 
Food Chain and Food Web (Ecosystem) EVS, B. Pharmacy 1st Year, Sem-II
Food Chain and Food Web (Ecosystem) EVS, B. Pharmacy 1st Year, Sem-IIFood Chain and Food Web (Ecosystem) EVS, B. Pharmacy 1st Year, Sem-II
Food Chain and Food Web (Ecosystem) EVS, B. Pharmacy 1st Year, Sem-II
 
Making and Justifying Mathematical Decisions.pdf
Making and Justifying Mathematical Decisions.pdfMaking and Justifying Mathematical Decisions.pdf
Making and Justifying Mathematical Decisions.pdf
 

Featured

How Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental HealthHow Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental Health
ThinkNow
 
Social Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie InsightsSocial Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie Insights
Kurio // The Social Media Age(ncy)
 

Featured (20)

2024 State of Marketing Report – by Hubspot
2024 State of Marketing Report – by Hubspot2024 State of Marketing Report – by Hubspot
2024 State of Marketing Report – by Hubspot
 
Everything You Need To Know About ChatGPT
Everything You Need To Know About ChatGPTEverything You Need To Know About ChatGPT
Everything You Need To Know About ChatGPT
 
Product Design Trends in 2024 | Teenage Engineerings
Product Design Trends in 2024 | Teenage EngineeringsProduct Design Trends in 2024 | Teenage Engineerings
Product Design Trends in 2024 | Teenage Engineerings
 
How Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental HealthHow Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental Health
 
AI Trends in Creative Operations 2024 by Artwork Flow.pdf
AI Trends in Creative Operations 2024 by Artwork Flow.pdfAI Trends in Creative Operations 2024 by Artwork Flow.pdf
AI Trends in Creative Operations 2024 by Artwork Flow.pdf
 
Skeleton Culture Code
Skeleton Culture CodeSkeleton Culture Code
Skeleton Culture Code
 
PEPSICO Presentation to CAGNY Conference Feb 2024
PEPSICO Presentation to CAGNY Conference Feb 2024PEPSICO Presentation to CAGNY Conference Feb 2024
PEPSICO Presentation to CAGNY Conference Feb 2024
 
Content Methodology: A Best Practices Report (Webinar)
Content Methodology: A Best Practices Report (Webinar)Content Methodology: A Best Practices Report (Webinar)
Content Methodology: A Best Practices Report (Webinar)
 
How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024
 
Social Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie InsightsSocial Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie Insights
 
Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024
 
5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary
 
ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd
 
Getting into the tech field. what next
Getting into the tech field. what next Getting into the tech field. what next
Getting into the tech field. what next
 
Google's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search IntentGoogle's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search Intent
 
How to have difficult conversations
How to have difficult conversations How to have difficult conversations
How to have difficult conversations
 
Introduction to Data Science
Introduction to Data ScienceIntroduction to Data Science
Introduction to Data Science
 
Time Management & Productivity - Best Practices
Time Management & Productivity -  Best PracticesTime Management & Productivity -  Best Practices
Time Management & Productivity - Best Practices
 
The six step guide to practical project management
The six step guide to practical project managementThe six step guide to practical project management
The six step guide to practical project management
 
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
 

Ml0016 advertising management and sales promotion

  • 1. Dear students get fully solved assignments by professionals Send your semester & Specialization name to our mail id : stuffstudy5@gmail.com or call us at : 098153-33456 (Prefer mailing. Call in emergency ) ASSIGNMENT DRIVE FALL 2015 PROGRAM MBADS – (SEM 4/SEM 6) MBAN2 / MBAFLEX – (SEM 4) PGDROMN– (SEM 2) SUBJECT CODE & NAME ML0016- Advertising Management and Sales Promotion SEMESTER 4 BK ID B1809 CREDITS 4 MARKS 60 Note: Answer all questions. Kindly note that answers for 10 marks questions should be approximately of 400 words. Each question is followed by evaluation scheme. 1. Explain the different types of Advertising copy. Answer: Classification of Advertisement Copy It is true that copy writing is an art and the copywriter has a very important role to play in advertising creativity. Copy writing does not admit any stereotyped rules and classification. There are various styles in which a copy can be prepared and presented. The following classification of advertisement copy may be studied; 1. Descriptive Copy– Thistype of copy describesthe pertinentandrelevant characteristics features of the product. It is very simple and of non- technical nature. It does not have any specialty which can attract the attention of the target consumers or may compel them to read it. It is very much similartoa pressaccount or newsitemsimplygivingrelevantinformation to the public without any stylish touch. 2. Scientific Copy – Such types of copies are technical in nature and generally used by drugs and pharmaceutical firmselaboratingthe propositions of properties and constituents of the product. It provides full information about the product and 2. Discussthe DAGMAR approach insetting objectivesandmeasuringeffectiveness of advertising. Answer : Meaning of DAGMAR approach Advertising is a part of marketing sometimes avoided by small business as it can be perceived as costly, ineffective and only appropriate for large corporations. However an understanding of
  • 2. advertising models such as AIDA and DAGMAR can help any small business plan more effective advertising. AIDA standsfor Attention,Interest, Desire and Action and can be used in small business marketing to improve campaigns, including those based on email autoresponders. DAGMAR (Defining Advertising Goals for Measured Advertising Results) is much more than a model for designing an advert, it is used to monitor a 3. Advertising is a paid form of communication. It has gained its significance since it attempts to build a positive attitude towards a product. Explain the characteristics and objectives of advertising. Answer : Three Main Advertising Objectives Increasing Sales and Profits One of the major objectives of advertising is to increase sales and profits. Some companies, like Internetbusinesses,onlyuse advertisingtoapprise people abouttheir products and services. These companiesdon'thave salesdepartments.Hence,theycanonlysell products and earn profits if they are activelyadvertising.Some forms of advertising lend themselves more to producing immediate profits. For example, direct response advertising 4 What is “above the line” and “below the line” activities with respect to marketing communications? Explain the concept in detail. Answer : Above-the-line There are a number of approaches to promotion that are open to organisations. Above-the-line promotions use mass media methods. This type of promotion focuses on advertising to a large audience. It includes print, online media, television and cinema advertising. As the fourth largest car company in the world, Kia is a big brand. It offers a range of products targeted at different market segments.kia-piccanto Above- 5 Describe the AIDA model of consumer response hierarchy with the help of diagram. Answer:The Hierarchyof EffectsModel was createdin1961 by RobertJ Lavidge andGary A Steiner. This marketing communication model, suggests that there are six steps from viewing a product advertisement(advert) toproductpurchase.The jobof the advertiser is to encourage the customer to go through the six steps and purchase the product. Hierarchy Of Effects Model 6. Describe some of the strategies for effective marketing and advertising in rural market. Answer : In order to utilize the immense potential in rural markets companies need to develop specific marketing mix and action plans, taking into consideration the complex set of factors that
  • 3. influenceconsumerbehaviour. Innovative companies which adopted an integrated approach have succeeded in utilizing marketing opportunities that rural areas offer. Different rural marketing strategies in India 1. Competitive strategy 1.1. Supplier:The company not onlyhas to make highqualityproductsbutalso has to sell them cheap. This can be achieved only if the Dear students get fully solved assignments by professionals Send your semester & Specialization name to our mail id : stuffstudy5@gmail.com or call us at : 098153-33456 (Prefer mailing. Call in emergency )