SlideShare una empresa de Scribd logo
MENINGITIS:
«Desde el pasado a la actualidad»
                   Sebastián Quinteros P.
                           Interno Pediatría
                                     UV-SF
                                      2012
Introducción

 La meningitis continúa siendo una enfermedad
  significativa
 Misteriosamente ha disminuido su incidencia en Chile
  hasta hace poco.
 La morbilidad y mortalidad en pediatría no ha
  cambiado durante los últimos 15 años en el mundo
 Notificación inmediata en meningitis meningocócicas
 La OMS ha estimado que la Enfermedad
  Meningocóccica (EM) fue causante de 171.000
  muertes a nivel mundial en el año 2000
Introducción


Definición:

La meningitis es una enfermedad del SNC,
caracterizada por la inflamación de las meninges
cerebrales (leptomeninges). Siendo la causa más
frecuente de este tipo, de etiología viral.



                          Medscape Meningitis (Reference)
Meninges Cerebrales
 Duramadre
      Resistente
      2 capas: Perióstica y Meníngea
      Divide en compartimientos
      Senos Venosos
 Aracnoides
    Granulaciones aracnoideas
    LCR
 Piamadre
    Interno
    Plexos coroideos

                               Medscape Meningitis (Reference)
Fisiopatología
 Respuesta inflamatoria es la importante
   Replicación agente causal en LCR
   Cambios en LCR (pH, lactato, proteínas,
    glucosa y conteo celular)
   TNF-alpha, IL-1, IL-6,IL-8, NO, PGE2, PAF
   Daño Pares Craneales e HTEC
   Trombosis y Vasoespasmo cerebral por daño
    endotelial
   Hipotensión sistémica secundaria
 Muerte por Shock Séptico o Trombosis           SNC


                            Medscape Meningitis (Reference)
Patogenia



 Hematógena: bacteria llega a los plexos
  coroideos y al LCR
 Vecindad: proceso séptico intracraneal
 Directa: TEC abierto, fractura en base de
  craneo, etc. (meningitis a repetición)




                          Medscape Meningitis (Reference)
Vía Hematógena


 M.O. alojados en la faringe
    2m y adultos  Streptococcus
     pneumoniae, Neisseria meningiditis, Streptococo
     pyogenes.
    Lactante-Prescolar Haemophilus influenza B
    Neonato y <2m Streptococo agalactiae, E. coli K-
     1, Listeria meningiditis.
 Cápsula que les permite evadir el sistema inmune.



                  Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
Características infección SNC

1.Meningitis Bacteriana Aguda: LCR purulento
  (PMN) de aspecto turbio y citrino (bacteriano)
2.Meningitis Aséptica: Sin infección bacteriana
  (viral o TBC)
3.Meningitis Simpática: proceso séptico vecino
  que inflama SN (otitis, osteomielitis IV, etc.)
4.Meningismo: Irritación meníngea sin
  inflamación



              Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
Etiología

 Streptococcus pneumoniae
 Neisseria meningiditis
 Bacilos gram negativos: E. coli
  Listeria monocitogenes
 Mycobacterium tuberculosis
 Virus Herpes simplex 1 y 2
 Streptococcus agalactiae
 Haemophilus influenzae tipo B
 VEB, Virus Herpes 6
Epidemiología
 95% meningitis bacterianas son producidas por
  meningococo y neumococo
 SGB continúa siendo la principal causa en neonatos
 Desde la introducción de la vacuna de HiB la
  enfermedad invasora disminuyó en 99%
 Ciertas drogas también producen meningitis
 4 y 35% de portación nasofaríngea de N. meningitidis
  en adultos sanos.
 Los aislamientos procedentes de portadores pueden
  ser capsulados o no capsulados, mientras los aislados
  de sangre y LCR son invariablemente capsulados
Situación Chile

 Año 94 se produjo resurgimiento Meningococo C que
  disminuyó desde el año 2001 (brotes VIII y IX)
 Año 2011 hubieron 74 casos con 11 muertes y Serogrupo
  B en 49%, W-135 34%, serogrupo C 13% y serogrupo Y
  3%
 Año 2012 hasta la fecha hay >80 casos país (mayor a la
  mediana quinquenal) con aumento drástico en últimas 16
  semanas
 La mayor incidencia es en Región Valparaíso y luego RM
 Aumentó la proporción de W-135 en RM sobretodo con
  aumento letalidad a 21%
Situación Chile
Meningitis Neonatal

 SGB continúa siendo el principal agente causal
 Asociado a contaminación por tracto genital
 El tratamiento ATB intraparto ha disminuido 80% la
  enfermedad temprana, no así la enfermedad tardía
  SGB
 Enfermedad tardía por SGB se produce 3-4 semanas
  produciendo meningitis o bacteremias

    Factores Predisponentes Meningitis Neo

• Prematuridad
• Infección Intraparto
• Ruptura Prolongada de Membranas
Meningitis Neonatal

 Bacilos gram negativos son raros en pediatría y
  más frecuentes en meningitis de neonatos
 Neonato posee menores defensas, deficiente paso de
  Ab en prematuros <32 semanas y mayor habilidad
  de la bacteria por atravesar barreras.
 VHS en neonatos se puede dar como local o
  diseminada (75% VHS-2)
 VHS se contagia en canal de parto, atraviesa incluso
  membranas íntegras o infección no genital
 Mayor infectividad ante primo infección
Meningitis Neonatal




 Infección materna con Listeria monocitogenes
  pueden provocar: aborto, parto pretermino o
  enfermedad temprana.
 Enfermedad temprana produce sépsis, mientras
  la tardía produce meningitis en el neonato.
Meningitis No Neonatal


 Neumococo      (streptococo gram positivo) es la principal
  causa, siendo alrededor de 7 serotipos los invasores
  (14, 6B, 19F, 18C, 23F, 4, and 9V).

 Lactantes menores son los de mayor riesgo
 Inicialmente coloniza la faringe, luego realiza una
  bacteriemia y llega a los plexos coroideos
 Desde el uso de la vacuna conjugada Prevenar®, la
  concurrencia a hospitales cayó en +75% en <24
  meses, disminuyendo principalmente la bacteriemia por
  neumococo.
Meningitis No Neonatal
 Neissseria meningiditis (diplococo gram   negativo)   se
  presenta comúnmente en individuos sanos
 Portador nasofaringeos intermitentes
 Puede presentarse de manera fulminante con altos
  índices de mortalidad (gran poder infectivo)
 Mayor incidencia en lactantes menores y < 5 años
 Segundo peak en 8-11 años
    Factores de Riesgo Portación Nasofaringea
                Serotipos
            Aumento Riesgo Meningococo
  •   Exposición a masas
  •   • A
      Asplenia                 • W-135
  •   Fumador Pasivo
  •   • B
      Déficit de complemento   • X
  •
  •   Portador Neumocócico
      Exposición
      • C                      • Y
  •
  •   Infección Tracto Respiratorio Superior
      Viajes a áreas endémicas
  •   Influenza A
Meningitis No Neonatal (Raros)
 Staphylococcus aureus: asociados a
  traumatismo encéfalo craneano, neurocirugía,
  derivación ventrículo-peritoneal, fuga de LCR,
  etc.
 Bacilos Gram Negativos: derivación ventrículo-
  peritoneal
 Mycobacterium tuberculosis          (BAAR):
  asociado a presencia de VIH (África sub-Sahariana) u
  otras patologías como DM, desnutrición, linfoma, ERC,
  etc.
 Borrelia burgdorferi
 Rickettsia rickettsii
Meningitis Aséptica

 La principal causa es viral (enterovirus) y son de
  predominio estacional
 Echovirus y Coxsaackievirus (vía fecal-oral)
 1 de 4 pacientes no se define etiología
 Clínicamente predomina fiebre inespecífica y REG
 Los niños presentan generalmente LCR normal y
  mejoran posterior a la PL, sin mayores complicaciones
 En USA la borreliosis es una causa importante
 TTO: Inmunoglobulinas e.v.
Meningitis Aséptica

     Causas de Encefalitis   Otras Causas de Meningitis




•   Virus Herpes Simplex
                             •   LES
•   Mycoplasma
                             •   Enfermedad de Kawasaki
•   Arbovirus
                             •   AINES: ibuprofeno
•   Virus Epstein Barr
                             •   Inmunoglobulinas e.v.
•   Rabies Virus
                             •   Muromonab-CD3
•   Virus Herpes Humano 6
                             •   Trimetoprin-
•   Ehrlichia sp.
                                 Sulfametoxazol
•   Rickettsia rickettsii
Encefalitis Herpética
 MAL PRONÓSTICO VITAL y NEUROLÓGICO
 Caracterizado por manifestaciones neurológicas
 Diagnóstico y tratamientos oportunos modifican
  sustancialmente el pronóstico


 Patogenia:
    Primoinfección HVS 1 (escolar) o 2 (RN)
    Entrada: oral u olfatoria (RN) o reactivación
     ganglio geniculado VIII PC
    Invasión directa neuronal y secundariamente LCR.

                Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
Manifestación Clínica

 Niños con VHS y meningitis bacteriana
  (meningococcemia principalmente) presentan
  «Aspecto Séptico»
 Síntomas    concordantes   con   HTEC   e
  Inflamación Meníngea.
 Irritabilidad Paradójica


            «RN presentan clínica
         inespecífica de meningitis»
Manifestación Clínica
 Malestar                  Nauseas
 CEG                       Rigidez de cuello
 Vómitos                   Fotofobia
 Status Mental Alterado    Dolor de Cabeza
 Convulsiones              Mialgias
 Fiebre                    Sepsis
 Letargia                  Shock
 Irritabilidad             FOM
 Anorexia                  Muerte
Manifestación Clínica
Manifestación Clínica
Manifestación Clínica




SIGNOS
MENINGEOS
CLÁSICOS
Historia Clínica

 ~25% meningitis por               Predisponen meningitis
  meningococo tienen FR:             bacteriana
    Trauma SNC                        OMA
    Implante Coclear                  Sinusitis
    Shunt Ventriculo-Peritoneal       Mastoiditis
    Fuga LCR
    Inmunodeficiencias: VIH
    Asplenia
    ERC
    Enfermedad Células
     Falciformes
Historia Clínica
Sospecha Encefalitis Herpética
 Encefalitis Neonatal:
     Clínica clínico inespecífica: fiebre, somnolencia
     Madre con herpes genital al parto
     RN con vesículas de cuero cabelludo o piel
     LCR con eritrocitos sin bacteria
 Otras edades:
     Fiebre      +      alucinaciones,              afasia
      sensitiva,           cambios                      de
      conducta, somnolencia, convulsiones.
     LCR compatible con meningitis viral

                Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
Examen Físico


1.Signos Vitales
2.Status Cardiopulmonar
3.Valoración de Conciencia (GCS)
4.Focalidad
5.Signos Meníngeos
Examen Físico
Examen Físico


6. Compromiso Articular (SGB o Meningococo)
7. Exantema (enterovirus)
8. Petequias (neumococo o meningococo)
9. Púrpura (neumococo o meningococo)
10.Vesículas (VHS)
Examen Físico
Diagnóstico

     «Ante toda sospecha de meningitis
            debe realizarse PL»


Contraindicaciones PL:
PL en todo:

1.RN febril Neurológicos Focales
    Déficits
2.Lactante conAumento Presión
    Signos de convulsión febril
3.Fiebre + Compromiso de Conciencia
     Intracraneana
4.Shock Séptico (considerar)
    Coagulopatía No corregida
5.Púrpura Febril (considerar)
    Compromiso Cardiopulmonar
Diagnóstico

1. Punción Lumbar:
   a. Citoquímico
   b. Cultivo/Gram
   c. Estudios Especiales (PCR)
2. ELP
3. Hemocultivo
4. Glicemia (ratio serum/CSF)
5. Hemograma
6. Cultivo de Lesiones
7. Proteína C Reactiva hasta caer fiebre (diaria)
8. PCR
Diagnóstico

LCR Bacteriano             LCR Viral

1. Pleocitosis LCR >1000   1. Pleocitosis LCR 50-500
   GB/mcL                     GB/mcL
2. Predominio de PMN       2. Predominio de Linfocitos
3. Gram LCR positivo       3. Aumento inicial de PMN
4. Cultivo positivo LCR
                           4. Glucorraquia normal
   (GOLD ESTÁNDAR)
5. Glucorraquia <50%       5. Proteinorraquia normal o
   (ratio plasma)             normo-elevada
6. Proteinorraquia
   >100mg/dL (1g/L)
Diagnóstico




 mg/dL
Tratamiento

 Contraindicación PL  Hemocultivo + ATB
 Ante Cultivo LCR negativo, pero Hemocultivo
  positivo, debe tratarse de todas formas a
  dosis de meningitis.
 UCIP:
   GCS ≤8
   Shock
   Compromiso Respiratorio
   Focalidad Neurológica
   Signos Clínicos de HTEC
Tratamiento


 Ampicilina 300mg/kg/día en 4 tomas +
  Cefotaxima 300mg/kg/día en 4 tomas
 + Aciclovir 60mg/kg/día en 3 tomas (RN o VHS)
 + Vancomicina 60mg/kg/día en 4 tomas (neumococo)


                  Meningococo 7 días
           SGB, Listeria, Neumococo 14 días
            E. Coli y Gram negativos 21 días
           VHS Neonatal 21 días con Aciclovir
Tratamiento


Vancomicina 60mg/kg/día
Ceftriaxona 100mg/kg/día                 EMPÍRICO >2m


 Vancomicina + Carbapenem o Quinolona (RHS PNC)


 Aciclovir ev 60mg/kg/día en 3 tomas (VHS)


 «PL nuevamente a las 24 hrs de tratamiento
     ATB en RN y Sospecha Neumococo»
Tratamiento

      Corticoides en Meningitis Bacteriana
Etiologías              • Haemophilus influenzae B
                        • Neumococo


Beneficios              • Disminuye mortalidad
                        • Disminuye pérdida auditiva
                        • Disminuye secuelas
                          neurológicas




 Dexamentasona ev 0,6mg/kg/día en 4
           dosis x 4 días
Tratamiento
Tto Encefalitis Herpética

1. Aciclovir x 21 días e.v. 60 mg/kg/día
2. Control PCR a 20 días, previo a suspender
   tratamiento
3. Manejo de convulsiones
4. Seguimiento y asistencia de secuelas
                 Diagnóstico:

1. Clínica fea
2. PCR + (repetir si es necesario)
3. Citoquimico LCR viral
4. Cultivo Negativo
                 Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
Tratamiento: soporte
A. Shock: Bolos SF o RL (Drogas VA)
B. Convulsiones y Focalidades: convulsiones >72 hrs son
  lesiones vasculares o abscesos cerebrales (RNM). Lorazepam yugular
C. Edema Intracerebral: riesgo de herniación tonsilar (TAC).
  Intentar CTC, diuréticos y manitol en el manejo.
D. Efusión Subdural: Riesgo de empiema subdural. Neurocirugía
E. SIADH: medición SV, diuresis, ELP y osmolaridad plasmatica
  (c/12h). Tratar con restricción hídrica ante Na<130mEq/L

   •   Natremia <135mEq/L
   •   Osm Plasma <270mOsm/Kg
   •   Osm Urinaria >2 veces la del plasma
   •   Na Urinario >30 mEq/L
   •   Ausencia de Hipovolemia o Deshidratación
Profilaxis

 Haemophilus influenzae B y Meningococo tienen alto riesgo
  de contagiosidad a contactos
 No es necesaria profilaxis en meningitis enterovirales
 La profilaxis ideal es comenzar antes de las 24hrs del
  contacto con el caso índice.
 Se considera profilaxis también en aquellos en contacto
  cercano y prolongado (>8hrs) hasta 7 días previos
 Profilaxis se realiza con:
    Rifampicina (uso pediátrico)
    Ciprofloxacino
    Ceftriaxona
Profilaxis: contactos cercanos

 Los que viven en la misma casa
 Los contactos en salas cuna
 Los expuestos directamente a secreciones
  respiratorias besos, resucitación boca a
  boca, intubación endotraqueal, o manejo de tubo
  endotraqueal)
 Los pasajeros en contacto directo con secreciones
  de un caso índice
 Los sentados directamente al lado del caso índice en
  viajes prolongados (duración > 8 horas).
Situación Chile: vacunas




   http://www.minsal.gob.cl/portal/url/page/minsalcl/g_proteccion/g_pni/presentacion_pni.html
Situación Chile: vacunas
Pronóstico


 Mueren entre 5-10% niños con meningitis bacteriana
 Alta secuelas en as meningitis neumococicas
 Secuelas: hipoacusia, hidrocefalia, déficit
  intelectual, espasticidad, ceguera, etc.
 Mortalidad neonatal es 10% SGB y 20% E coli
 Secuelas neurológicas neonataales son mayores a las
  pediátricas con 30% SGB y 50% gram negativos
Meningitis en pediatria

Más contenido relacionado

La actualidad más candente

ITU en pediatria
ITU  en pediatria ITU  en pediatria
ITU en pediatria
Gerardo Cabrera Cabrera
 
Meningitis
Meningitis Meningitis
Meningitis
Carlos Pech Lugo
 
Meningitis En Pediatría 2015
Meningitis En Pediatría 2015Meningitis En Pediatría 2015
Meningitis En Pediatría 2015
francisco soto
 
SEPSIS NEONATAL.
SEPSIS NEONATAL.SEPSIS NEONATAL.
SEPSIS NEONATAL.
Adán Olvera
 
Convulsiones en pediatría
Convulsiones en pediatríaConvulsiones en pediatría
Convulsiones en pediatría
Hospital Guadix
 
Insuficiencia Renal Aguda en Pediatria
Insuficiencia Renal Aguda en PediatriaInsuficiencia Renal Aguda en Pediatria
Insuficiencia Renal Aguda en Pediatria
Mariemma Ferrer
 
Exantemas en pediatría
Exantemas en pediatríaExantemas en pediatría
Exantemas en pediatría
cosasdelpac
 
Tuberculosis Infantil . DiagnóStico Y Tratamiento
Tuberculosis Infantil . DiagnóStico Y TratamientoTuberculosis Infantil . DiagnóStico Y Tratamiento
Tuberculosis Infantil . DiagnóStico Y Tratamiento
xelaleph
 
Tos ferina y síndrome coqueluchoide
Tos ferina y síndrome  coqueluchoideTos ferina y síndrome  coqueluchoide
Tos ferina y síndrome coqueluchoide
Andrea Mar Ramirez Garcia
 
Fiebre sin foco en pediatria
Fiebre sin foco en pediatriaFiebre sin foco en pediatria
Fiebre sin foco en pediatria
docenciaaltopalancia
 
Laringotraqueitis Aguda (CRUP)
Laringotraqueitis Aguda (CRUP)Laringotraqueitis Aguda (CRUP)
Laringotraqueitis Aguda (CRUP)
Edwin Daniel Maldonado Domínguez
 
Bronquiolitis
BronquiolitisBronquiolitis
Sindrome convulsivo en pediatria
Sindrome convulsivo en pediatriaSindrome convulsivo en pediatria
Sindrome convulsivo en pediatria
Otman Ortiz
 
Enfermedades Exantematicas
Enfermedades ExantematicasEnfermedades Exantematicas
Enfermedades Exantematicas
Oswaldo A. Garibay
 
Itu infeccion de tracto urinario pediatria
Itu infeccion de tracto urinario pediatriaItu infeccion de tracto urinario pediatria
Itu infeccion de tracto urinario pediatria
Alexis R. Leon Melendez
 
Encefalitis
EncefalitisEncefalitis
Encefalitis
Furia Argentina
 
Enfermedad Diarreica Aguda En El Paciente Pediátrico
Enfermedad Diarreica Aguda En El Paciente PediátricoEnfermedad Diarreica Aguda En El Paciente Pediátrico
Enfermedad Diarreica Aguda En El Paciente Pediátrico
Edwin Daniel Maldonado Domínguez
 
Enfermedades exantemáticas
Enfermedades exantemáticasEnfermedades exantemáticas
Sepsis neonatal pediatria
Sepsis neonatal pediatriaSepsis neonatal pediatria
Sepsis neonatal pediatria
Camilo Losada
 
Meningitis y Encefalitis
Meningitis y EncefalitisMeningitis y Encefalitis
Meningitis y Encefalitis
Ana Milena Osorio Patiño
 

La actualidad más candente (20)

ITU en pediatria
ITU  en pediatria ITU  en pediatria
ITU en pediatria
 
Meningitis
Meningitis Meningitis
Meningitis
 
Meningitis En Pediatría 2015
Meningitis En Pediatría 2015Meningitis En Pediatría 2015
Meningitis En Pediatría 2015
 
SEPSIS NEONATAL.
SEPSIS NEONATAL.SEPSIS NEONATAL.
SEPSIS NEONATAL.
 
Convulsiones en pediatría
Convulsiones en pediatríaConvulsiones en pediatría
Convulsiones en pediatría
 
Insuficiencia Renal Aguda en Pediatria
Insuficiencia Renal Aguda en PediatriaInsuficiencia Renal Aguda en Pediatria
Insuficiencia Renal Aguda en Pediatria
 
Exantemas en pediatría
Exantemas en pediatríaExantemas en pediatría
Exantemas en pediatría
 
Tuberculosis Infantil . DiagnóStico Y Tratamiento
Tuberculosis Infantil . DiagnóStico Y TratamientoTuberculosis Infantil . DiagnóStico Y Tratamiento
Tuberculosis Infantil . DiagnóStico Y Tratamiento
 
Tos ferina y síndrome coqueluchoide
Tos ferina y síndrome  coqueluchoideTos ferina y síndrome  coqueluchoide
Tos ferina y síndrome coqueluchoide
 
Fiebre sin foco en pediatria
Fiebre sin foco en pediatriaFiebre sin foco en pediatria
Fiebre sin foco en pediatria
 
Laringotraqueitis Aguda (CRUP)
Laringotraqueitis Aguda (CRUP)Laringotraqueitis Aguda (CRUP)
Laringotraqueitis Aguda (CRUP)
 
Bronquiolitis
BronquiolitisBronquiolitis
Bronquiolitis
 
Sindrome convulsivo en pediatria
Sindrome convulsivo en pediatriaSindrome convulsivo en pediatria
Sindrome convulsivo en pediatria
 
Enfermedades Exantematicas
Enfermedades ExantematicasEnfermedades Exantematicas
Enfermedades Exantematicas
 
Itu infeccion de tracto urinario pediatria
Itu infeccion de tracto urinario pediatriaItu infeccion de tracto urinario pediatria
Itu infeccion de tracto urinario pediatria
 
Encefalitis
EncefalitisEncefalitis
Encefalitis
 
Enfermedad Diarreica Aguda En El Paciente Pediátrico
Enfermedad Diarreica Aguda En El Paciente PediátricoEnfermedad Diarreica Aguda En El Paciente Pediátrico
Enfermedad Diarreica Aguda En El Paciente Pediátrico
 
Enfermedades exantemáticas
Enfermedades exantemáticasEnfermedades exantemáticas
Enfermedades exantemáticas
 
Sepsis neonatal pediatria
Sepsis neonatal pediatriaSepsis neonatal pediatria
Sepsis neonatal pediatria
 
Meningitis y Encefalitis
Meningitis y EncefalitisMeningitis y Encefalitis
Meningitis y Encefalitis
 

Destacado

Meningitis en Pediatría
Meningitis en PediatríaMeningitis en Pediatría
Meningitis en Pediatría
MINSA
 
caso clínico pediatría meningitis
caso clínico pediatría meningitiscaso clínico pediatría meningitis
caso clínico pediatría meningitis
fregarme666
 
CTO PEDIATRIA EDICION 8
CTO PEDIATRIA EDICION 8 CTO PEDIATRIA EDICION 8
CTO PEDIATRIA EDICION 8
Pattyhuate Chavez
 
Intoxicaciones en Pediatria.
Intoxicaciones en Pediatria. Intoxicaciones en Pediatria.
Intoxicaciones en Pediatria.
Edgar Acosta
 
FISIOPATOLOGIA DE LA MENINGITIS BACTERIANA (HARRISON)
FISIOPATOLOGIA DE LA MENINGITIS BACTERIANA (HARRISON)FISIOPATOLOGIA DE LA MENINGITIS BACTERIANA (HARRISON)
FISIOPATOLOGIA DE LA MENINGITIS BACTERIANA (HARRISON)
Laura Ahumada
 
Rabia
RabiaRabia
Tuberculosis en pediatria
Tuberculosis en pediatriaTuberculosis en pediatria
Tuberculosis en pediatria
Mario Suarez Montalvo
 
Meningitis
MeningitisMeningitis
Meningitis
lSMlCesar
 

Destacado (8)

Meningitis en Pediatría
Meningitis en PediatríaMeningitis en Pediatría
Meningitis en Pediatría
 
caso clínico pediatría meningitis
caso clínico pediatría meningitiscaso clínico pediatría meningitis
caso clínico pediatría meningitis
 
CTO PEDIATRIA EDICION 8
CTO PEDIATRIA EDICION 8 CTO PEDIATRIA EDICION 8
CTO PEDIATRIA EDICION 8
 
Intoxicaciones en Pediatria.
Intoxicaciones en Pediatria. Intoxicaciones en Pediatria.
Intoxicaciones en Pediatria.
 
FISIOPATOLOGIA DE LA MENINGITIS BACTERIANA (HARRISON)
FISIOPATOLOGIA DE LA MENINGITIS BACTERIANA (HARRISON)FISIOPATOLOGIA DE LA MENINGITIS BACTERIANA (HARRISON)
FISIOPATOLOGIA DE LA MENINGITIS BACTERIANA (HARRISON)
 
Rabia
RabiaRabia
Rabia
 
Tuberculosis en pediatria
Tuberculosis en pediatriaTuberculosis en pediatria
Tuberculosis en pediatria
 
Meningitis
MeningitisMeningitis
Meningitis
 

Similar a Meningitis en pediatria

Meningitisenpediatria 121107200630-phpapp02
Meningitisenpediatria 121107200630-phpapp02Meningitisenpediatria 121107200630-phpapp02
Meningitisenpediatria 121107200630-phpapp02
Dr. Percy Huarcarpuma
 
meningitisenpediatria-121107200630-phpapp02 (2).pdf
meningitisenpediatria-121107200630-phpapp02 (2).pdfmeningitisenpediatria-121107200630-phpapp02 (2).pdf
meningitisenpediatria-121107200630-phpapp02 (2).pdf
ssuser141cac
 
Mb Bv Super
Mb Bv SuperMb Bv Super
Mb Bv Super
Beve08
 
meningitis.pptx
meningitis.pptxmeningitis.pptx
meningitis.pptx
yulyalemancadena
 
Meningitis
MeningitisMeningitis
Sistema nervioso-central-20112
Sistema nervioso-central-20112Sistema nervioso-central-20112
Sistema nervioso-central-20112
damian1099
 
NEUROINFECCIONES.docx
NEUROINFECCIONES.docxNEUROINFECCIONES.docx
NEUROINFECCIONES.docx
MalenyBalbuena
 
meningitisviralymeningitisbacteriana-170926023237.pdf
meningitisviralymeningitisbacteriana-170926023237.pdfmeningitisviralymeningitisbacteriana-170926023237.pdf
meningitisviralymeningitisbacteriana-170926023237.pdf
OscarEnriqueCovarrub1
 
Meningitis viral y meningitis bacteriana
Meningitis viral y meningitis bacterianaMeningitis viral y meningitis bacteriana
Meningitis viral y meningitis bacteriana
Margie Rodas
 
Meningoencefalitis PEDIATRIA
Meningoencefalitis PEDIATRIAMeningoencefalitis PEDIATRIA
Meningoencefalitis PEDIATRIA
UCM
 
infeciones del snc
infeciones del sncinfeciones del snc
infeciones del snc
Elvin Medina
 
Infecciones el snc 2020 v1.0
Infecciones el snc 2020 v1.0Infecciones el snc 2020 v1.0
Infecciones el snc 2020 v1.0
MAHINOJOSA45
 
Infecciones del Sistema Nervioso
Infecciones del Sistema NerviosoInfecciones del Sistema Nervioso
Infecciones del Sistema Nervioso
International Red Cross and Red Crescent Movement
 
Ecefalitis viral
Ecefalitis viralEcefalitis viral
3 meningitis -_foro_viviana_ribon
3 meningitis -_foro_viviana_ribon3 meningitis -_foro_viviana_ribon
3 meningitis -_foro_viviana_ribon
doctor-Alfredo-Bolano
 
Meningitis lewis
Meningitis lewisMeningitis lewis
Meningitis lewis
Elwis Laveriano
 
INFECCIONES DEL SITEMA NERVIOSO CENTRAL .pptx
INFECCIONES DEL SITEMA NERVIOSO CENTRAL .pptxINFECCIONES DEL SITEMA NERVIOSO CENTRAL .pptx
INFECCIONES DEL SITEMA NERVIOSO CENTRAL .pptx
KarlaMassielMartinez
 
Meningitis.
Meningitis.Meningitis.
Meningitis.
Alexander Hernandez
 
Meningitis exposicion final
Meningitis exposicion finalMeningitis exposicion final
Meningitis exposicion final
Marien Baez Jimenez
 
Infecciones Meningocócicas
Infecciones MeningocócicasInfecciones Meningocócicas
Infecciones Meningocócicas
Geramel De la Cruz
 

Similar a Meningitis en pediatria (20)

Meningitisenpediatria 121107200630-phpapp02
Meningitisenpediatria 121107200630-phpapp02Meningitisenpediatria 121107200630-phpapp02
Meningitisenpediatria 121107200630-phpapp02
 
meningitisenpediatria-121107200630-phpapp02 (2).pdf
meningitisenpediatria-121107200630-phpapp02 (2).pdfmeningitisenpediatria-121107200630-phpapp02 (2).pdf
meningitisenpediatria-121107200630-phpapp02 (2).pdf
 
Mb Bv Super
Mb Bv SuperMb Bv Super
Mb Bv Super
 
meningitis.pptx
meningitis.pptxmeningitis.pptx
meningitis.pptx
 
Meningitis
MeningitisMeningitis
Meningitis
 
Sistema nervioso-central-20112
Sistema nervioso-central-20112Sistema nervioso-central-20112
Sistema nervioso-central-20112
 
NEUROINFECCIONES.docx
NEUROINFECCIONES.docxNEUROINFECCIONES.docx
NEUROINFECCIONES.docx
 
meningitisviralymeningitisbacteriana-170926023237.pdf
meningitisviralymeningitisbacteriana-170926023237.pdfmeningitisviralymeningitisbacteriana-170926023237.pdf
meningitisviralymeningitisbacteriana-170926023237.pdf
 
Meningitis viral y meningitis bacteriana
Meningitis viral y meningitis bacterianaMeningitis viral y meningitis bacteriana
Meningitis viral y meningitis bacteriana
 
Meningoencefalitis PEDIATRIA
Meningoencefalitis PEDIATRIAMeningoencefalitis PEDIATRIA
Meningoencefalitis PEDIATRIA
 
infeciones del snc
infeciones del sncinfeciones del snc
infeciones del snc
 
Infecciones el snc 2020 v1.0
Infecciones el snc 2020 v1.0Infecciones el snc 2020 v1.0
Infecciones el snc 2020 v1.0
 
Infecciones del Sistema Nervioso
Infecciones del Sistema NerviosoInfecciones del Sistema Nervioso
Infecciones del Sistema Nervioso
 
Ecefalitis viral
Ecefalitis viralEcefalitis viral
Ecefalitis viral
 
3 meningitis -_foro_viviana_ribon
3 meningitis -_foro_viviana_ribon3 meningitis -_foro_viviana_ribon
3 meningitis -_foro_viviana_ribon
 
Meningitis lewis
Meningitis lewisMeningitis lewis
Meningitis lewis
 
INFECCIONES DEL SITEMA NERVIOSO CENTRAL .pptx
INFECCIONES DEL SITEMA NERVIOSO CENTRAL .pptxINFECCIONES DEL SITEMA NERVIOSO CENTRAL .pptx
INFECCIONES DEL SITEMA NERVIOSO CENTRAL .pptx
 
Meningitis.
Meningitis.Meningitis.
Meningitis.
 
Meningitis exposicion final
Meningitis exposicion finalMeningitis exposicion final
Meningitis exposicion final
 
Infecciones Meningocócicas
Infecciones MeningocócicasInfecciones Meningocócicas
Infecciones Meningocócicas
 

Más de Sebastian Quinteros

Alcoholismo en Atención Cerrada
Alcoholismo en Atención CerradaAlcoholismo en Atención Cerrada
Alcoholismo en Atención Cerrada
Sebastian Quinteros
 
TEC Moderado
TEC ModeradoTEC Moderado
TEC Moderado
Sebastian Quinteros
 
Esquizofrenia
EsquizofreniaEsquizofrenia
Esquizofrenia
Sebastian Quinteros
 
Síndrome de Hombro doloroso
Síndrome de Hombro dolorosoSíndrome de Hombro doloroso
Síndrome de Hombro doloroso
Sebastian Quinteros
 
Neumotórax espontáneo
Neumotórax espontáneoNeumotórax espontáneo
Neumotórax espontáneo
Sebastian Quinteros
 
Estenosis carotidea
Estenosis carotideaEstenosis carotidea
Estenosis carotidea
Sebastian Quinteros
 
Insuficiencia Renal Aguda
Insuficiencia Renal AgudaInsuficiencia Renal Aguda
Insuficiencia Renal Aguda
Sebastian Quinteros
 
Infección del Tracto Urinario
Infección del Tracto UrinarioInfección del Tracto Urinario
Infección del Tracto Urinario
Sebastian Quinteros
 
Cirugía: Nodulos y Cáncer de Tiroides
Cirugía: Nodulos y Cáncer de TiroidesCirugía: Nodulos y Cáncer de Tiroides
Cirugía: Nodulos y Cáncer de Tiroides
Sebastian Quinteros
 
Enfermedad de Parkinson
Enfermedad de ParkinsonEnfermedad de Parkinson
Enfermedad de Parkinson
Sebastian Quinteros
 
Pruebas hepaticas
Pruebas hepaticasPruebas hepaticas
Pruebas hepaticas
Sebastian Quinteros
 
Enfermedad Inflamatoria Pelvica
Enfermedad Inflamatoria PelvicaEnfermedad Inflamatoria Pelvica
Enfermedad Inflamatoria Pelvica
Sebastian Quinteros
 
Cancer de Ovario
Cancer de OvarioCancer de Ovario
Cancer de Ovario
Sebastian Quinteros
 
Guia para el tratamiento del infarto cerebral agudo
Guia para el tratamiento del infarto cerebral agudoGuia para el tratamiento del infarto cerebral agudo
Guia para el tratamiento del infarto cerebral agudo
Sebastian Quinteros
 
Trastorno de Deficit Atencional
Trastorno de Deficit AtencionalTrastorno de Deficit Atencional
Trastorno de Deficit Atencional
Sebastian Quinteros
 
Demencias
DemenciasDemencias
Cefalea y Migraña
Cefalea y MigrañaCefalea y Migraña
Cefalea y Migraña
Sebastian Quinteros
 
Ictus
IctusIctus
Epilepsia
EpilepsiaEpilepsia
Manual GINA de bolsillo
Manual GINA de bolsilloManual GINA de bolsillo
Manual GINA de bolsillo
Sebastian Quinteros
 

Más de Sebastian Quinteros (20)

Alcoholismo en Atención Cerrada
Alcoholismo en Atención CerradaAlcoholismo en Atención Cerrada
Alcoholismo en Atención Cerrada
 
TEC Moderado
TEC ModeradoTEC Moderado
TEC Moderado
 
Esquizofrenia
EsquizofreniaEsquizofrenia
Esquizofrenia
 
Síndrome de Hombro doloroso
Síndrome de Hombro dolorosoSíndrome de Hombro doloroso
Síndrome de Hombro doloroso
 
Neumotórax espontáneo
Neumotórax espontáneoNeumotórax espontáneo
Neumotórax espontáneo
 
Estenosis carotidea
Estenosis carotideaEstenosis carotidea
Estenosis carotidea
 
Insuficiencia Renal Aguda
Insuficiencia Renal AgudaInsuficiencia Renal Aguda
Insuficiencia Renal Aguda
 
Infección del Tracto Urinario
Infección del Tracto UrinarioInfección del Tracto Urinario
Infección del Tracto Urinario
 
Cirugía: Nodulos y Cáncer de Tiroides
Cirugía: Nodulos y Cáncer de TiroidesCirugía: Nodulos y Cáncer de Tiroides
Cirugía: Nodulos y Cáncer de Tiroides
 
Enfermedad de Parkinson
Enfermedad de ParkinsonEnfermedad de Parkinson
Enfermedad de Parkinson
 
Pruebas hepaticas
Pruebas hepaticasPruebas hepaticas
Pruebas hepaticas
 
Enfermedad Inflamatoria Pelvica
Enfermedad Inflamatoria PelvicaEnfermedad Inflamatoria Pelvica
Enfermedad Inflamatoria Pelvica
 
Cancer de Ovario
Cancer de OvarioCancer de Ovario
Cancer de Ovario
 
Guia para el tratamiento del infarto cerebral agudo
Guia para el tratamiento del infarto cerebral agudoGuia para el tratamiento del infarto cerebral agudo
Guia para el tratamiento del infarto cerebral agudo
 
Trastorno de Deficit Atencional
Trastorno de Deficit AtencionalTrastorno de Deficit Atencional
Trastorno de Deficit Atencional
 
Demencias
DemenciasDemencias
Demencias
 
Cefalea y Migraña
Cefalea y MigrañaCefalea y Migraña
Cefalea y Migraña
 
Ictus
IctusIctus
Ictus
 
Epilepsia
EpilepsiaEpilepsia
Epilepsia
 
Manual GINA de bolsillo
Manual GINA de bolsilloManual GINA de bolsillo
Manual GINA de bolsillo
 

Último

FÁRMACOS Antibioticos Betalactamicos Diapositivas
FÁRMACOS Antibioticos Betalactamicos DiapositivasFÁRMACOS Antibioticos Betalactamicos Diapositivas
FÁRMACOS Antibioticos Betalactamicos Diapositivas
Yalianabastidas
 
Programa de escuela sabatica tercer trimestre 2024
Programa de escuela sabatica tercer trimestre 2024Programa de escuela sabatica tercer trimestre 2024
Programa de escuela sabatica tercer trimestre 2024
ericksongp
 
Protocolos de sincronizacion y poliovulacion.ppt
Protocolos de sincronizacion y poliovulacion.pptProtocolos de sincronizacion y poliovulacion.ppt
Protocolos de sincronizacion y poliovulacion.ppt
MiltonCardenasLoja
 
MATERIAL DE ATLAS_COMPLETO_DE_ANATOMIA_HUMANA.pdf
MATERIAL DE ATLAS_COMPLETO_DE_ANATOMIA_HUMANA.pdfMATERIAL DE ATLAS_COMPLETO_DE_ANATOMIA_HUMANA.pdf
MATERIAL DE ATLAS_COMPLETO_DE_ANATOMIA_HUMANA.pdf
MiNeyi1
 
Cromosomopatías en pediatria , las principales.pdf
Cromosomopatías en pediatria , las principales.pdfCromosomopatías en pediatria , las principales.pdf
Cromosomopatías en pediatria , las principales.pdf
CamilaGmezMeja
 
Responsabilidad afectiva Taller didáctico.pptx
Responsabilidad afectiva Taller didáctico.pptxResponsabilidad afectiva Taller didáctico.pptx
Responsabilidad afectiva Taller didáctico.pptx
franciscofernandez106395
 
el autismo causas, consecuencias y prevencion.pptx
el autismo causas, consecuencias y prevencion.pptxel autismo causas, consecuencias y prevencion.pptx
el autismo causas, consecuencias y prevencion.pptx
mseminariotrelles24
 
Diapositivas sobre la anemia ferropénica.pptx
Diapositivas sobre la anemia ferropénica.pptxDiapositivas sobre la anemia ferropénica.pptx
Diapositivas sobre la anemia ferropénica.pptx
tnluquees
 
ginecoobstetricia distocias del parto nuevo.pptx
ginecoobstetricia distocias del parto nuevo.pptxginecoobstetricia distocias del parto nuevo.pptx
ginecoobstetricia distocias del parto nuevo.pptx
ximenaip7728
 
Fisiologiadelejercicio_lopez_chicharro.pdf
Fisiologiadelejercicio_lopez_chicharro.pdfFisiologiadelejercicio_lopez_chicharro.pdf
Fisiologiadelejercicio_lopez_chicharro.pdf
MiNeyi1
 
LIBRO DE INTRODUCION A LA PSICOLOGIA- DECIMO TERCERA EDICION
LIBRO DE INTRODUCION A LA PSICOLOGIA- DECIMO TERCERA EDICIONLIBRO DE INTRODUCION A LA PSICOLOGIA- DECIMO TERCERA EDICION
LIBRO DE INTRODUCION A LA PSICOLOGIA- DECIMO TERCERA EDICION
DayanaGonzalez104844
 
Small Girls Call Aero City 9873940964 Provide Best And Top Girl Service And N...
Small Girls Call Aero City 9873940964 Provide Best And Top Girl Service And N...Small Girls Call Aero City 9873940964 Provide Best And Top Girl Service And N...
Small Girls Call Aero City 9873940964 Provide Best And Top Girl Service And N...
%$A19%
 
Guía canina biomecanica en tipos de oclusion
Guía canina biomecanica en tipos de oclusionGuía canina biomecanica en tipos de oclusion
Guía canina biomecanica en tipos de oclusion
ESTIBALIZALPAZ
 
Biopatologia de la obesidad, trastorno que afecta a nivel mundial
Biopatologia de la obesidad, trastorno que afecta a nivel mundialBiopatologia de la obesidad, trastorno que afecta a nivel mundial
Biopatologia de la obesidad, trastorno que afecta a nivel mundial
axelalonzo2
 
Presentación astana-Promocion y prevención
Presentación astana-Promocion y prevenciónPresentación astana-Promocion y prevención
Presentación astana-Promocion y prevención
MelDaliaTValera
 
CARPETA GERENCIAL JEFES DE PISO 2016.ppt
CARPETA GERENCIAL JEFES DE PISO 2016.pptCARPETA GERENCIAL JEFES DE PISO 2016.ppt
CARPETA GERENCIAL JEFES DE PISO 2016.ppt
DianaMOrtiz2
 
INFORMACION DE ENFERMERIA TECNICA Y SALUD
INFORMACION DE ENFERMERIA TECNICA  Y  SALUDINFORMACION DE ENFERMERIA TECNICA  Y  SALUD
INFORMACION DE ENFERMERIA TECNICA Y SALUD
floresroldankatheryn
 
Obstruccion intestinal en Cirugía General.pdf
Obstruccion intestinal en Cirugía General.pdfObstruccion intestinal en Cirugía General.pdf
Obstruccion intestinal en Cirugía General.pdf
hannyrujano2
 
HERNIOPLASTIA INGUINAL LAPAROSCOPICA TIPOS
HERNIOPLASTIA INGUINAL LAPAROSCOPICA TIPOSHERNIOPLASTIA INGUINAL LAPAROSCOPICA TIPOS
HERNIOPLASTIA INGUINAL LAPAROSCOPICA TIPOS
Carlos Quezada
 
2. Historia Clínica Perinatal Básica (HCPB).ppt
2. Historia Clínica Perinatal Básica (HCPB).ppt2. Historia Clínica Perinatal Básica (HCPB).ppt
2. Historia Clínica Perinatal Básica (HCPB).ppt
alex94rm
 

Último (20)

FÁRMACOS Antibioticos Betalactamicos Diapositivas
FÁRMACOS Antibioticos Betalactamicos DiapositivasFÁRMACOS Antibioticos Betalactamicos Diapositivas
FÁRMACOS Antibioticos Betalactamicos Diapositivas
 
Programa de escuela sabatica tercer trimestre 2024
Programa de escuela sabatica tercer trimestre 2024Programa de escuela sabatica tercer trimestre 2024
Programa de escuela sabatica tercer trimestre 2024
 
Protocolos de sincronizacion y poliovulacion.ppt
Protocolos de sincronizacion y poliovulacion.pptProtocolos de sincronizacion y poliovulacion.ppt
Protocolos de sincronizacion y poliovulacion.ppt
 
MATERIAL DE ATLAS_COMPLETO_DE_ANATOMIA_HUMANA.pdf
MATERIAL DE ATLAS_COMPLETO_DE_ANATOMIA_HUMANA.pdfMATERIAL DE ATLAS_COMPLETO_DE_ANATOMIA_HUMANA.pdf
MATERIAL DE ATLAS_COMPLETO_DE_ANATOMIA_HUMANA.pdf
 
Cromosomopatías en pediatria , las principales.pdf
Cromosomopatías en pediatria , las principales.pdfCromosomopatías en pediatria , las principales.pdf
Cromosomopatías en pediatria , las principales.pdf
 
Responsabilidad afectiva Taller didáctico.pptx
Responsabilidad afectiva Taller didáctico.pptxResponsabilidad afectiva Taller didáctico.pptx
Responsabilidad afectiva Taller didáctico.pptx
 
el autismo causas, consecuencias y prevencion.pptx
el autismo causas, consecuencias y prevencion.pptxel autismo causas, consecuencias y prevencion.pptx
el autismo causas, consecuencias y prevencion.pptx
 
Diapositivas sobre la anemia ferropénica.pptx
Diapositivas sobre la anemia ferropénica.pptxDiapositivas sobre la anemia ferropénica.pptx
Diapositivas sobre la anemia ferropénica.pptx
 
ginecoobstetricia distocias del parto nuevo.pptx
ginecoobstetricia distocias del parto nuevo.pptxginecoobstetricia distocias del parto nuevo.pptx
ginecoobstetricia distocias del parto nuevo.pptx
 
Fisiologiadelejercicio_lopez_chicharro.pdf
Fisiologiadelejercicio_lopez_chicharro.pdfFisiologiadelejercicio_lopez_chicharro.pdf
Fisiologiadelejercicio_lopez_chicharro.pdf
 
LIBRO DE INTRODUCION A LA PSICOLOGIA- DECIMO TERCERA EDICION
LIBRO DE INTRODUCION A LA PSICOLOGIA- DECIMO TERCERA EDICIONLIBRO DE INTRODUCION A LA PSICOLOGIA- DECIMO TERCERA EDICION
LIBRO DE INTRODUCION A LA PSICOLOGIA- DECIMO TERCERA EDICION
 
Small Girls Call Aero City 9873940964 Provide Best And Top Girl Service And N...
Small Girls Call Aero City 9873940964 Provide Best And Top Girl Service And N...Small Girls Call Aero City 9873940964 Provide Best And Top Girl Service And N...
Small Girls Call Aero City 9873940964 Provide Best And Top Girl Service And N...
 
Guía canina biomecanica en tipos de oclusion
Guía canina biomecanica en tipos de oclusionGuía canina biomecanica en tipos de oclusion
Guía canina biomecanica en tipos de oclusion
 
Biopatologia de la obesidad, trastorno que afecta a nivel mundial
Biopatologia de la obesidad, trastorno que afecta a nivel mundialBiopatologia de la obesidad, trastorno que afecta a nivel mundial
Biopatologia de la obesidad, trastorno que afecta a nivel mundial
 
Presentación astana-Promocion y prevención
Presentación astana-Promocion y prevenciónPresentación astana-Promocion y prevención
Presentación astana-Promocion y prevención
 
CARPETA GERENCIAL JEFES DE PISO 2016.ppt
CARPETA GERENCIAL JEFES DE PISO 2016.pptCARPETA GERENCIAL JEFES DE PISO 2016.ppt
CARPETA GERENCIAL JEFES DE PISO 2016.ppt
 
INFORMACION DE ENFERMERIA TECNICA Y SALUD
INFORMACION DE ENFERMERIA TECNICA  Y  SALUDINFORMACION DE ENFERMERIA TECNICA  Y  SALUD
INFORMACION DE ENFERMERIA TECNICA Y SALUD
 
Obstruccion intestinal en Cirugía General.pdf
Obstruccion intestinal en Cirugía General.pdfObstruccion intestinal en Cirugía General.pdf
Obstruccion intestinal en Cirugía General.pdf
 
HERNIOPLASTIA INGUINAL LAPAROSCOPICA TIPOS
HERNIOPLASTIA INGUINAL LAPAROSCOPICA TIPOSHERNIOPLASTIA INGUINAL LAPAROSCOPICA TIPOS
HERNIOPLASTIA INGUINAL LAPAROSCOPICA TIPOS
 
2. Historia Clínica Perinatal Básica (HCPB).ppt
2. Historia Clínica Perinatal Básica (HCPB).ppt2. Historia Clínica Perinatal Básica (HCPB).ppt
2. Historia Clínica Perinatal Básica (HCPB).ppt
 

Meningitis en pediatria

  • 1. MENINGITIS: «Desde el pasado a la actualidad» Sebastián Quinteros P. Interno Pediatría UV-SF 2012
  • 2. Introducción  La meningitis continúa siendo una enfermedad significativa  Misteriosamente ha disminuido su incidencia en Chile hasta hace poco.  La morbilidad y mortalidad en pediatría no ha cambiado durante los últimos 15 años en el mundo  Notificación inmediata en meningitis meningocócicas  La OMS ha estimado que la Enfermedad Meningocóccica (EM) fue causante de 171.000 muertes a nivel mundial en el año 2000
  • 3. Introducción Definición: La meningitis es una enfermedad del SNC, caracterizada por la inflamación de las meninges cerebrales (leptomeninges). Siendo la causa más frecuente de este tipo, de etiología viral. Medscape Meningitis (Reference)
  • 4. Meninges Cerebrales  Duramadre  Resistente  2 capas: Perióstica y Meníngea  Divide en compartimientos  Senos Venosos  Aracnoides  Granulaciones aracnoideas  LCR  Piamadre  Interno  Plexos coroideos Medscape Meningitis (Reference)
  • 5. Fisiopatología  Respuesta inflamatoria es la importante  Replicación agente causal en LCR  Cambios en LCR (pH, lactato, proteínas, glucosa y conteo celular)  TNF-alpha, IL-1, IL-6,IL-8, NO, PGE2, PAF  Daño Pares Craneales e HTEC  Trombosis y Vasoespasmo cerebral por daño endotelial  Hipotensión sistémica secundaria  Muerte por Shock Séptico o Trombosis SNC Medscape Meningitis (Reference)
  • 6. Patogenia  Hematógena: bacteria llega a los plexos coroideos y al LCR  Vecindad: proceso séptico intracraneal  Directa: TEC abierto, fractura en base de craneo, etc. (meningitis a repetición) Medscape Meningitis (Reference)
  • 7. Vía Hematógena  M.O. alojados en la faringe  2m y adultos  Streptococcus pneumoniae, Neisseria meningiditis, Streptococo pyogenes.  Lactante-Prescolar Haemophilus influenza B  Neonato y <2m Streptococo agalactiae, E. coli K- 1, Listeria meningiditis. Cápsula que les permite evadir el sistema inmune. Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
  • 8. Características infección SNC 1.Meningitis Bacteriana Aguda: LCR purulento (PMN) de aspecto turbio y citrino (bacteriano) 2.Meningitis Aséptica: Sin infección bacteriana (viral o TBC) 3.Meningitis Simpática: proceso séptico vecino que inflama SN (otitis, osteomielitis IV, etc.) 4.Meningismo: Irritación meníngea sin inflamación Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
  • 9. Etiología  Streptococcus pneumoniae  Neisseria meningiditis  Bacilos gram negativos: E. coli Listeria monocitogenes  Mycobacterium tuberculosis  Virus Herpes simplex 1 y 2  Streptococcus agalactiae  Haemophilus influenzae tipo B  VEB, Virus Herpes 6
  • 10. Epidemiología  95% meningitis bacterianas son producidas por meningococo y neumococo  SGB continúa siendo la principal causa en neonatos  Desde la introducción de la vacuna de HiB la enfermedad invasora disminuyó en 99%  Ciertas drogas también producen meningitis  4 y 35% de portación nasofaríngea de N. meningitidis en adultos sanos.  Los aislamientos procedentes de portadores pueden ser capsulados o no capsulados, mientras los aislados de sangre y LCR son invariablemente capsulados
  • 11. Situación Chile  Año 94 se produjo resurgimiento Meningococo C que disminuyó desde el año 2001 (brotes VIII y IX)  Año 2011 hubieron 74 casos con 11 muertes y Serogrupo B en 49%, W-135 34%, serogrupo C 13% y serogrupo Y 3%  Año 2012 hasta la fecha hay >80 casos país (mayor a la mediana quinquenal) con aumento drástico en últimas 16 semanas  La mayor incidencia es en Región Valparaíso y luego RM  Aumentó la proporción de W-135 en RM sobretodo con aumento letalidad a 21%
  • 13. Meningitis Neonatal  SGB continúa siendo el principal agente causal  Asociado a contaminación por tracto genital  El tratamiento ATB intraparto ha disminuido 80% la enfermedad temprana, no así la enfermedad tardía SGB  Enfermedad tardía por SGB se produce 3-4 semanas produciendo meningitis o bacteremias Factores Predisponentes Meningitis Neo • Prematuridad • Infección Intraparto • Ruptura Prolongada de Membranas
  • 14. Meningitis Neonatal  Bacilos gram negativos son raros en pediatría y más frecuentes en meningitis de neonatos  Neonato posee menores defensas, deficiente paso de Ab en prematuros <32 semanas y mayor habilidad de la bacteria por atravesar barreras.  VHS en neonatos se puede dar como local o diseminada (75% VHS-2)  VHS se contagia en canal de parto, atraviesa incluso membranas íntegras o infección no genital  Mayor infectividad ante primo infección
  • 15. Meningitis Neonatal  Infección materna con Listeria monocitogenes pueden provocar: aborto, parto pretermino o enfermedad temprana.  Enfermedad temprana produce sépsis, mientras la tardía produce meningitis en el neonato.
  • 16. Meningitis No Neonatal  Neumococo (streptococo gram positivo) es la principal causa, siendo alrededor de 7 serotipos los invasores (14, 6B, 19F, 18C, 23F, 4, and 9V).  Lactantes menores son los de mayor riesgo  Inicialmente coloniza la faringe, luego realiza una bacteriemia y llega a los plexos coroideos  Desde el uso de la vacuna conjugada Prevenar®, la concurrencia a hospitales cayó en +75% en <24 meses, disminuyendo principalmente la bacteriemia por neumococo.
  • 17. Meningitis No Neonatal  Neissseria meningiditis (diplococo gram negativo) se presenta comúnmente en individuos sanos  Portador nasofaringeos intermitentes  Puede presentarse de manera fulminante con altos índices de mortalidad (gran poder infectivo)  Mayor incidencia en lactantes menores y < 5 años  Segundo peak en 8-11 años Factores de Riesgo Portación Nasofaringea Serotipos Aumento Riesgo Meningococo • Exposición a masas • • A Asplenia • W-135 • Fumador Pasivo • • B Déficit de complemento • X • • Portador Neumocócico Exposición • C • Y • • Infección Tracto Respiratorio Superior Viajes a áreas endémicas • Influenza A
  • 18. Meningitis No Neonatal (Raros)  Staphylococcus aureus: asociados a traumatismo encéfalo craneano, neurocirugía, derivación ventrículo-peritoneal, fuga de LCR, etc.  Bacilos Gram Negativos: derivación ventrículo- peritoneal  Mycobacterium tuberculosis (BAAR): asociado a presencia de VIH (África sub-Sahariana) u otras patologías como DM, desnutrición, linfoma, ERC, etc.  Borrelia burgdorferi  Rickettsia rickettsii
  • 19. Meningitis Aséptica  La principal causa es viral (enterovirus) y son de predominio estacional  Echovirus y Coxsaackievirus (vía fecal-oral)  1 de 4 pacientes no se define etiología  Clínicamente predomina fiebre inespecífica y REG  Los niños presentan generalmente LCR normal y mejoran posterior a la PL, sin mayores complicaciones  En USA la borreliosis es una causa importante  TTO: Inmunoglobulinas e.v.
  • 20. Meningitis Aséptica Causas de Encefalitis Otras Causas de Meningitis • Virus Herpes Simplex • LES • Mycoplasma • Enfermedad de Kawasaki • Arbovirus • AINES: ibuprofeno • Virus Epstein Barr • Inmunoglobulinas e.v. • Rabies Virus • Muromonab-CD3 • Virus Herpes Humano 6 • Trimetoprin- • Ehrlichia sp. Sulfametoxazol • Rickettsia rickettsii
  • 21. Encefalitis Herpética  MAL PRONÓSTICO VITAL y NEUROLÓGICO  Caracterizado por manifestaciones neurológicas  Diagnóstico y tratamientos oportunos modifican sustancialmente el pronóstico  Patogenia:  Primoinfección HVS 1 (escolar) o 2 (RN)  Entrada: oral u olfatoria (RN) o reactivación ganglio geniculado VIII PC  Invasión directa neuronal y secundariamente LCR. Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
  • 22. Manifestación Clínica  Niños con VHS y meningitis bacteriana (meningococcemia principalmente) presentan «Aspecto Séptico»  Síntomas concordantes con HTEC e Inflamación Meníngea.  Irritabilidad Paradójica «RN presentan clínica inespecífica de meningitis»
  • 23. Manifestación Clínica  Malestar  Nauseas  CEG  Rigidez de cuello  Vómitos  Fotofobia  Status Mental Alterado  Dolor de Cabeza  Convulsiones  Mialgias  Fiebre  Sepsis  Letargia  Shock  Irritabilidad  FOM  Anorexia  Muerte
  • 27. Historia Clínica  ~25% meningitis por  Predisponen meningitis meningococo tienen FR: bacteriana  Trauma SNC  OMA  Implante Coclear  Sinusitis  Shunt Ventriculo-Peritoneal  Mastoiditis  Fuga LCR  Inmunodeficiencias: VIH  Asplenia  ERC  Enfermedad Células Falciformes
  • 29. Sospecha Encefalitis Herpética  Encefalitis Neonatal: Clínica clínico inespecífica: fiebre, somnolencia Madre con herpes genital al parto RN con vesículas de cuero cabelludo o piel LCR con eritrocitos sin bacteria  Otras edades: Fiebre + alucinaciones, afasia sensitiva, cambios de conducta, somnolencia, convulsiones. LCR compatible con meningitis viral Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
  • 30. Examen Físico 1.Signos Vitales 2.Status Cardiopulmonar 3.Valoración de Conciencia (GCS) 4.Focalidad 5.Signos Meníngeos
  • 32. Examen Físico 6. Compromiso Articular (SGB o Meningococo) 7. Exantema (enterovirus) 8. Petequias (neumococo o meningococo) 9. Púrpura (neumococo o meningococo) 10.Vesículas (VHS)
  • 34. Diagnóstico «Ante toda sospecha de meningitis debe realizarse PL» Contraindicaciones PL: PL en todo: 1.RN febril Neurológicos Focales  Déficits 2.Lactante conAumento Presión  Signos de convulsión febril 3.Fiebre + Compromiso de Conciencia Intracraneana 4.Shock Séptico (considerar)  Coagulopatía No corregida 5.Púrpura Febril (considerar)  Compromiso Cardiopulmonar
  • 35. Diagnóstico 1. Punción Lumbar: a. Citoquímico b. Cultivo/Gram c. Estudios Especiales (PCR) 2. ELP 3. Hemocultivo 4. Glicemia (ratio serum/CSF) 5. Hemograma 6. Cultivo de Lesiones 7. Proteína C Reactiva hasta caer fiebre (diaria) 8. PCR
  • 36. Diagnóstico LCR Bacteriano LCR Viral 1. Pleocitosis LCR >1000 1. Pleocitosis LCR 50-500 GB/mcL GB/mcL 2. Predominio de PMN 2. Predominio de Linfocitos 3. Gram LCR positivo 3. Aumento inicial de PMN 4. Cultivo positivo LCR 4. Glucorraquia normal (GOLD ESTÁNDAR) 5. Glucorraquia <50% 5. Proteinorraquia normal o (ratio plasma) normo-elevada 6. Proteinorraquia >100mg/dL (1g/L)
  • 38. Tratamiento  Contraindicación PL  Hemocultivo + ATB  Ante Cultivo LCR negativo, pero Hemocultivo positivo, debe tratarse de todas formas a dosis de meningitis.  UCIP:  GCS ≤8  Shock  Compromiso Respiratorio  Focalidad Neurológica  Signos Clínicos de HTEC
  • 39. Tratamiento  Ampicilina 300mg/kg/día en 4 tomas + Cefotaxima 300mg/kg/día en 4 tomas  + Aciclovir 60mg/kg/día en 3 tomas (RN o VHS)  + Vancomicina 60mg/kg/día en 4 tomas (neumococo) Meningococo 7 días SGB, Listeria, Neumococo 14 días E. Coli y Gram negativos 21 días VHS Neonatal 21 días con Aciclovir
  • 40. Tratamiento Vancomicina 60mg/kg/día Ceftriaxona 100mg/kg/día EMPÍRICO >2m  Vancomicina + Carbapenem o Quinolona (RHS PNC)  Aciclovir ev 60mg/kg/día en 3 tomas (VHS) «PL nuevamente a las 24 hrs de tratamiento ATB en RN y Sospecha Neumococo»
  • 41. Tratamiento Corticoides en Meningitis Bacteriana Etiologías • Haemophilus influenzae B • Neumococo Beneficios • Disminuye mortalidad • Disminuye pérdida auditiva • Disminuye secuelas neurológicas Dexamentasona ev 0,6mg/kg/día en 4 dosis x 4 días
  • 43. Tto Encefalitis Herpética 1. Aciclovir x 21 días e.v. 60 mg/kg/día 2. Control PCR a 20 días, previo a suspender tratamiento 3. Manejo de convulsiones 4. Seguimiento y asistencia de secuelas Diagnóstico: 1. Clínica fea 2. PCR + (repetir si es necesario) 3. Citoquimico LCR viral 4. Cultivo Negativo Dr. Cofré, Infectólogo Hospital Luis Calvo Mackena
  • 44. Tratamiento: soporte A. Shock: Bolos SF o RL (Drogas VA) B. Convulsiones y Focalidades: convulsiones >72 hrs son lesiones vasculares o abscesos cerebrales (RNM). Lorazepam yugular C. Edema Intracerebral: riesgo de herniación tonsilar (TAC). Intentar CTC, diuréticos y manitol en el manejo. D. Efusión Subdural: Riesgo de empiema subdural. Neurocirugía E. SIADH: medición SV, diuresis, ELP y osmolaridad plasmatica (c/12h). Tratar con restricción hídrica ante Na<130mEq/L • Natremia <135mEq/L • Osm Plasma <270mOsm/Kg • Osm Urinaria >2 veces la del plasma • Na Urinario >30 mEq/L • Ausencia de Hipovolemia o Deshidratación
  • 45. Profilaxis  Haemophilus influenzae B y Meningococo tienen alto riesgo de contagiosidad a contactos  No es necesaria profilaxis en meningitis enterovirales  La profilaxis ideal es comenzar antes de las 24hrs del contacto con el caso índice.  Se considera profilaxis también en aquellos en contacto cercano y prolongado (>8hrs) hasta 7 días previos  Profilaxis se realiza con:  Rifampicina (uso pediátrico)  Ciprofloxacino  Ceftriaxona
  • 46. Profilaxis: contactos cercanos  Los que viven en la misma casa  Los contactos en salas cuna  Los expuestos directamente a secreciones respiratorias besos, resucitación boca a boca, intubación endotraqueal, o manejo de tubo endotraqueal)  Los pasajeros en contacto directo con secreciones de un caso índice  Los sentados directamente al lado del caso índice en viajes prolongados (duración > 8 horas).
  • 47. Situación Chile: vacunas http://www.minsal.gob.cl/portal/url/page/minsalcl/g_proteccion/g_pni/presentacion_pni.html
  • 49. Pronóstico  Mueren entre 5-10% niños con meningitis bacteriana  Alta secuelas en as meningitis neumococicas  Secuelas: hipoacusia, hidrocefalia, déficit intelectual, espasticidad, ceguera, etc.  Mortalidad neonatal es 10% SGB y 20% E coli  Secuelas neurológicas neonataales son mayores a las pediátricas con 30% SGB y 50% gram negativos

Notas del editor

  1. Duramadre= PaquimeningitisPiamadre + Aracnoides= LeptomeningesDivisores compartimentales: Falx cerebral, Tentorium, hoz cerebelo
  2. Meninges como barrera al SIMenor severidad si no atraviesa la barrera pialEdema cerebral  HTECHTEC contribuye a hipoperfusión cerebral y anaerobiosis (hipoglucorraquia)Cuando el cuerpo trata de combatir la infección, el problema puede empeorar, vasos sanguíneos se vuelven permeables y permiten que las células blancas de la sangre, los fluidos y otras partículas que combaten la infección al entrar en las meninges y el cerebro. Este proceso, a su vez, provoca inflamación del cerebro y eventualmente puede resultar en la disminución del flujo sanguíneo a partes del cerebro, el empeoramiento de los síntomas de la infección.HTEC: por edema vasogénico, inflamación tejido cerebral (citotoxico) y bloqueo de flujo de LCR (edema interticial)
  3. Inoculación Inicial: piel, nasofaringe, pulmón, gastrointestinal, genitourinario, Vía hematógena es la más frecuente (inicia desde nasofaringe)  neumococo y meningococoVecindad: OMC, Sinusitis, congénitas, tromboflebitis seno cavernoso, etc.La trombosis séptica de seno cavernoso describe un proceso tromboflebítico de las venas intracraneales de etiología infecciosa, en donde se pueden vincular como entidades etiológicas las infecciones de origen facial, de origen en senos paranasales (sinusitis), menos frecuente de infecciones otológicas, infecciones odontogénicas, faríngeas, y focos sépticos distantes. 
  4. Virus Herpes Simplex (VHS)= infeccion local (cutanea o lesión membranosa cutanea) o diseminada (encefalitis o proceso diseminado)
  5. Listeria: leches no pasteurizadas, quesos, vegetales no limpios, carnes no cocidas, etc.
  6. Prevenar®= vacuna heptavalentePrevenar 13 ®= (PnC7:4, 6B, 9V, 14, 18C, 19F, 23F) y además los serotipos 1, 3, 5, 6A, 7F y 19A.
  7. RN: fiebre, hipotermia, letargia, irritabilidad, Irritabilidad P]aradójica: tranquilo cuando está acostado y llanto cuando lo mueven
  8. Focalidad: papiledema, diplopia, pupilas poco reactivas, fontanelas abombadas, pupilas dilatadas uni-bilateral, Parálisis PCSignosMeningeos: su ausencia no excluye meningitis
  9. Los VHS que afectan el SNC comúnmente no producen lesiones vesiculares
  10. Realizar TAC Cerebro previamente.If a mass lesion, hemorrhage, midline shift, effacement of the basilar cisterns, or effacement of the sulci is noted, lumbar puncture should be deferred andantimicrobial therapy started promptly.
  11. 90% Prot C Reactivas son &gt;90 en MBA y son máximasdesde 24 hrs del inicioingreso.CSF examination should include cell count and differential count, glucose concentration, and protein mea-surements. These values must be interpreted based on the child’s age; normal CSF values for an infant are very different from those of an adult. Serum glucose concentration should be measured to determine the ratio between serum and CSF glucose as a percentage. A Gram stain of the CSF should be performed promptly as well as cultures of the CSF and bloodSIADH (35%)HiponatremiaLeucocitosis (normal)
  12. PL traumática= se asume una corrección de 1 GB/1000 GR
  13. Normal= 200-400 mg/L = 20-40 mg/dL
  14. CTC concurrentes a la primera dosis de ATB o previo a la primera dosis.
  15. Focalidadescomunmente son secundarias a daños vasculares producidos por la meningitis
  16. RIFAMPICINA (fármaco de elección): Adultos: 600 mg c/12 h, durante 2 días. Niños: 10 mg/kg/12 h, durante 2 días. (máx 600 mg/12 h). Niños &lt; 1 mes: 5 mg/kg/12 h, durante 2 días