SlideShare una empresa de Scribd logo
1 de 70
Zkušenosti z Opendoor Workshop „ Working with Human Genome Sequence “ Hinxton, Cambridge, UK 23.-25. ledna 2006 MUDr. Marek Turnovec Ústav biologie a lékařské genetiky 2. LF UK a FN Motol 11. dubna 2006
Hinxton Genome Campus
Working with Human Genome Sequence ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Modul 1: Sequences Formats and Retrieval ,[object Object],[object Object],[object Object],[object Object]
Přístup k sekvencím ,[object Object],[object Object],[object Object],[object Object],[object Object]
Formát dat ,[object Object],[object Object],[object Object],[object Object]
Rozdíly ve formátech EMBL a GenBank/DDBJ ,[object Object],[object Object],[object Object],[object Object]
Zkratky použité ve formátu EMBL ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
EMBL 1/3 ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
EMBL 2/3 ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
EMBL 3/3 ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
GenBank/DDBJ  1/3 ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
GenBank/DDBJ 2/3 ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
GenBank/DDBJ 3/3 ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
FASTA >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX IENY >embl|AA961746|AA961746 or60c12.s1 NCI_CGAP_GC3 Homo sapiens cDNA clone IMAGE:1600246 3' similar to gb:M17885 60S ACIDIC RIBOSOMAL PROTEIN P0 (HUMAN);, mRNA sequence. ... actttttaaagaagtaagcctttatttccttgttttgcaaataaaactggctaagttggt tgctttttggtgattagtcaaagagaccaaatcccatatcctcgtccgactcctccgact cttccttggcttcaaccttagctggggctgcagcagcacgaggagcagctgtggtggcag cagcataggggcagcagcacaaaggcagatggatcagccaagaaggccttgaccttttca gcaagtgggaaggtgtaatccgtctccacagacaaggccaggactcgtttgtacccgttg atgatagaatggggtactgatgcaacagttgggtagccaatctgcagacagacactggca acattgcggacaccctccaggaagcgagaatgcagagtttcctctgtgatatcaagcact tcagggttgtagatgctgccattgtcgaacacctgctggatgaccagcccaaaggagaag ggggagatgttgagcatgttcagcagcgtggctttcgctggctccactttgtctccagtc ttgatcagctgcacatcactcaggatttcaatggtgcccttggagattttagtggtgata cctaaagctggaaaaaggaggtcttctcgggcccgagaccagtgttctgggctggcacag tgacttcacat popis sekvence
 
DDBJ screenshot
 
 
 
UniProt ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
UniProt
Komplexnější databáze ,[object Object],[object Object],[object Object],[object Object],[object Object]
 
 
Reference Sequence Project ,[object Object],[object Object],[object Object],[object Object],[object Object]
InterPro ,[object Object],[object Object],[object Object]
Expasy ,[object Object],[object Object],[object Object]
Expasy
Module 2: de novo  Analysis of Sequence ,[object Object],[object Object],[object Object]
Používané nástroje ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
B asic  L ocal  A lignment  S earch  T ool ,[object Object],[object Object],[object Object],[object Object]
B asic  L ocal  A lignment  S earch  T ool ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
PSI -BLAST ,[object Object],[object Object],[object Object],[object Object],[object Object]
http://www.ncbi.nlm.nih.gov/blast/
BLAST
 
 
http://www.ncbi.nlm.nih.gov/gorf/
http://www.ncbi.nlm.nih.gov/spidey/ ,[object Object]
Clustal W
JalView
GeneDoc
Module 3: Genome Browsing ,[object Object],[object Object]
Genome browsers – co nabízí? ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Genome browsers ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
+ dobrá provázanost s ostatními službami NCBI (PubMed)
+ přímočaré ovládání  + dostupnost i starších sestavení
+ databáze genů potvrzených cDNA klony plné délky
+ různé pohledy  + k dispozici i archiv (starší sestavení)  + snadné získávání dat  + „evidence“
VEGA –  Ve rtebrate  G enome  A nnotated
BioMart ,[object Object],[object Object],[object Object],[object Object]
1 Co chceme prohledávát? (sestavení, organismus)
22 2
3
 
Module 4: Exploring Function and Disease ,[object Object],[object Object],[object Object],[object Object]
 
 
Exprese ve tkáních Podobné proteiny
 
Module 5: Sequence Variation ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
SNP Ensembl ->   Gene variation info
 
NCBI: dbSNP
Další zdroje ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Module 6: Comparative Sequence Analysis ,[object Object],[object Object]
Homologní geny ,[object Object],[object Object],[object Object],[object Object],[object Object]
Nástroje ,[object Object],[object Object],[object Object],[object Object]
Děkuji za pozornost

Más contenido relacionado

Destacado

2024 State of Marketing Report – by Hubspot
2024 State of Marketing Report – by Hubspot2024 State of Marketing Report – by Hubspot
2024 State of Marketing Report – by HubspotMarius Sescu
 
Everything You Need To Know About ChatGPT
Everything You Need To Know About ChatGPTEverything You Need To Know About ChatGPT
Everything You Need To Know About ChatGPTExpeed Software
 
Product Design Trends in 2024 | Teenage Engineerings
Product Design Trends in 2024 | Teenage EngineeringsProduct Design Trends in 2024 | Teenage Engineerings
Product Design Trends in 2024 | Teenage EngineeringsPixeldarts
 
How Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental HealthHow Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental HealthThinkNow
 
AI Trends in Creative Operations 2024 by Artwork Flow.pdf
AI Trends in Creative Operations 2024 by Artwork Flow.pdfAI Trends in Creative Operations 2024 by Artwork Flow.pdf
AI Trends in Creative Operations 2024 by Artwork Flow.pdfmarketingartwork
 
PEPSICO Presentation to CAGNY Conference Feb 2024
PEPSICO Presentation to CAGNY Conference Feb 2024PEPSICO Presentation to CAGNY Conference Feb 2024
PEPSICO Presentation to CAGNY Conference Feb 2024Neil Kimberley
 
Content Methodology: A Best Practices Report (Webinar)
Content Methodology: A Best Practices Report (Webinar)Content Methodology: A Best Practices Report (Webinar)
Content Methodology: A Best Practices Report (Webinar)contently
 
How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024Albert Qian
 
Social Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie InsightsSocial Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie InsightsKurio // The Social Media Age(ncy)
 
Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024Search Engine Journal
 
5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summarySpeakerHub
 
ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd Clark Boyd
 
Getting into the tech field. what next
Getting into the tech field. what next Getting into the tech field. what next
Getting into the tech field. what next Tessa Mero
 
Google's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search IntentGoogle's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search IntentLily Ray
 
Time Management & Productivity - Best Practices
Time Management & Productivity -  Best PracticesTime Management & Productivity -  Best Practices
Time Management & Productivity - Best PracticesVit Horky
 
The six step guide to practical project management
The six step guide to practical project managementThe six step guide to practical project management
The six step guide to practical project managementMindGenius
 
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...RachelPearson36
 

Destacado (20)

2024 State of Marketing Report – by Hubspot
2024 State of Marketing Report – by Hubspot2024 State of Marketing Report – by Hubspot
2024 State of Marketing Report – by Hubspot
 
Everything You Need To Know About ChatGPT
Everything You Need To Know About ChatGPTEverything You Need To Know About ChatGPT
Everything You Need To Know About ChatGPT
 
Product Design Trends in 2024 | Teenage Engineerings
Product Design Trends in 2024 | Teenage EngineeringsProduct Design Trends in 2024 | Teenage Engineerings
Product Design Trends in 2024 | Teenage Engineerings
 
How Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental HealthHow Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental Health
 
AI Trends in Creative Operations 2024 by Artwork Flow.pdf
AI Trends in Creative Operations 2024 by Artwork Flow.pdfAI Trends in Creative Operations 2024 by Artwork Flow.pdf
AI Trends in Creative Operations 2024 by Artwork Flow.pdf
 
Skeleton Culture Code
Skeleton Culture CodeSkeleton Culture Code
Skeleton Culture Code
 
PEPSICO Presentation to CAGNY Conference Feb 2024
PEPSICO Presentation to CAGNY Conference Feb 2024PEPSICO Presentation to CAGNY Conference Feb 2024
PEPSICO Presentation to CAGNY Conference Feb 2024
 
Content Methodology: A Best Practices Report (Webinar)
Content Methodology: A Best Practices Report (Webinar)Content Methodology: A Best Practices Report (Webinar)
Content Methodology: A Best Practices Report (Webinar)
 
How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024
 
Social Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie InsightsSocial Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie Insights
 
Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024
 
5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary
 
ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd
 
Getting into the tech field. what next
Getting into the tech field. what next Getting into the tech field. what next
Getting into the tech field. what next
 
Google's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search IntentGoogle's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search Intent
 
How to have difficult conversations
How to have difficult conversations How to have difficult conversations
How to have difficult conversations
 
Introduction to Data Science
Introduction to Data ScienceIntroduction to Data Science
Introduction to Data Science
 
Time Management & Productivity - Best Practices
Time Management & Productivity -  Best PracticesTime Management & Productivity -  Best Practices
Time Management & Productivity - Best Practices
 
The six step guide to practical project management
The six step guide to practical project managementThe six step guide to practical project management
The six step guide to practical project management
 
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
 

Zkušenosti z Opendoor Workshop „Working with Human Genome Sequence“

  • 1. Zkušenosti z Opendoor Workshop „ Working with Human Genome Sequence “ Hinxton, Cambridge, UK 23.-25. ledna 2006 MUDr. Marek Turnovec Ústav biologie a lékařské genetiky 2. LF UK a FN Motol 11. dubna 2006
  • 3.
  • 4.
  • 5.
  • 6.
  • 7.
  • 8.
  • 9.
  • 10.
  • 11.
  • 12.
  • 13.
  • 14.
  • 15. FASTA >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX IENY >embl|AA961746|AA961746 or60c12.s1 NCI_CGAP_GC3 Homo sapiens cDNA clone IMAGE:1600246 3' similar to gb:M17885 60S ACIDIC RIBOSOMAL PROTEIN P0 (HUMAN);, mRNA sequence. ... actttttaaagaagtaagcctttatttccttgttttgcaaataaaactggctaagttggt tgctttttggtgattagtcaaagagaccaaatcccatatcctcgtccgactcctccgact cttccttggcttcaaccttagctggggctgcagcagcacgaggagcagctgtggtggcag cagcataggggcagcagcacaaaggcagatggatcagccaagaaggccttgaccttttca gcaagtgggaaggtgtaatccgtctccacagacaaggccaggactcgtttgtacccgttg atgatagaatggggtactgatgcaacagttgggtagccaatctgcagacagacactggca acattgcggacaccctccaggaagcgagaatgcagagtttcctctgtgatatcaagcact tcagggttgtagatgctgccattgtcgaacacctgctggatgaccagcccaaaggagaag ggggagatgttgagcatgttcagcagcgtggctttcgctggctccactttgtctccagtc ttgatcagctgcacatcactcaggatttcaatggtgcccttggagattttagtggtgata cctaaagctggaaaaaggaggtcttctcgggcccgagaccagtgttctgggctggcacag tgacttcacat popis sekvence
  • 16.  
  • 18.  
  • 19.  
  • 20.  
  • 21.
  • 23.
  • 24.  
  • 25.  
  • 26.
  • 27.
  • 28.
  • 30.
  • 31.
  • 32.
  • 33.
  • 34.
  • 36. BLAST
  • 37.  
  • 38.  
  • 40.
  • 44.
  • 45.
  • 46.
  • 47. + dobrá provázanost s ostatními službami NCBI (PubMed)
  • 48. + přímočaré ovládání + dostupnost i starších sestavení
  • 49. + databáze genů potvrzených cDNA klony plné délky
  • 50. + různé pohledy + k dispozici i archiv (starší sestavení) + snadné získávání dat + „evidence“
  • 51. VEGA – Ve rtebrate G enome A nnotated
  • 52.
  • 53. 1 Co chceme prohledávát? (sestavení, organismus)
  • 54. 22 2
  • 55. 3
  • 56.  
  • 57.
  • 58.  
  • 59.  
  • 60. Exprese ve tkáních Podobné proteiny
  • 61.  
  • 62.
  • 63. SNP Ensembl -> Gene variation info
  • 64.  
  • 66.
  • 67.
  • 68.
  • 69.