SlideShare una empresa de Scribd logo
1 de 26
Jack Tuszynski
Cross Cancer Institute
Department of Physics
University of Alberta
Edmonton, Canada
http://www.phys.ualberta.ca/~jtus
“Accelerating Chemotherapy
Drug Discovery with High
Performance Computing and
Analytics”
“Modern” Pharmacy: Rx
Modern Drug DevelopmentModern Drug Development
Success Rate 1:100,000 !Success Rate 1:100,000 !
00 22 44 66 88 1010 1212 1414 1616
DiscoveryDiscovery
Preclinical testingPreclinical testing
Phase IPhase I
Phase IIPhase II
Phase IIIPhase III
ApprovalApproval
Post marketPost market
100,000100,000
100100
55
11
Time in years Cost $1B
Identify disease
Isolate protein
Find drug
Preclinical testing
GENOMICS, PROTEOMICS & BIOPHARM.
HIGH THROUGHPUT SCREENING
MOLECULAR MODELING
VIRTUAL SCREENING
COMBINATORIAL CHEMISTRY
IN VITRO & IN SILICO ADME MODELS
Potentially producing many more targets
and “personalized” targets
Screening up to 100,000 compounds a
day for activity against a target protein
Using a computer to
predict activity
Rapidly producing vast numbers
of compounds
Computer graphics & models help improve activity
Tissue and computer models begin to replace animal testing
VIRTUAL SCREENING
MOLECULAR MODELING
The Evolution in Drug Design and Development
5
Integration of biological dataIntegration of biological data
impacts drug developmentimpacts drug development
information stored in the genetic code (DNA)information stored in the genetic code (DNA)
protein sequencesprotein sequences
3D structures of biomolecules3D structures of biomolecules
experimental results from various sources (kd, IC50,experimental results from various sources (kd, IC50,
expression)expression)
clinical dataclinical data
patient statisticspatient statistics
scientific literaturescientific literature
6
……and leads toand leads to
computational explosioncomputational explosion
An avalanche of data:An avalanche of data:
SequencesSequences
Functional relationsFunctional relations
StructuresStructures
This requiresThis requires
computationalcomputational
approachesapproaches
• 100’s of completed genomes
• 1000’s of known reactions
• 10,000’s of known 3D structures
• 100,000’s of protein-ligand
interactions
• 1,000,000’s of known proteins &
enzymes
• Decades of biological/chemical
know-how
• Computational & Mathematical
resources
The Push to Systems Biology
77
Key areas ofKey areas of
bioinformaticsbioinformatics
organisation of knowledge
(sequences, structures,
functional data)
e.g. homology
searches
Specifically for drug discovery:
PDB : 50,000 proteins + homologs
1500 targets (human proteins)
Approx. 400 (80 in cancer) utilized
Orange Book: 1800 medicinal drugs
Drug Bank: 4900 drugs
Cancer chemotherapy drugs: 103
Protein-drug interactions but also
Protein-protein interactions
Molecular Targets:Cancer Cell NetworkMolecular Targets:Cancer Cell Network
A very complex but algorithmic system
Based on a lock-and-key principle
We will find keys to all these locks by 2061
CANCER CHEMOTHERAPY DRUGS
Approximately 100 standard chemotherapeutic drugs:
1)Alkylating agents: Genotoxic (20-25)
2) Plant alkaloids: Inhibition of mitosis (10-15)
3) Antimetabolites: Inhibition of base synthesis (15-20)
4) Antibiotics: Derived from Streptomyces (10-15)
5) Targeted antibodies: Bind cell surface receptors (5-10)
6) Hormones: Inhibit or stimulate hormone signaling (15-20)
7) Directly targeting small molecules
8)Other indirect effects: Angiogenesis or immune modulators (10-15)
Number of current chemotherapy targets: 101
Number of chemotherapy drugs: 102
Potential Targets (Pharmacogenomics): 103
Paclitaxel
Cisplatin
Methotrexate
Trastuzumab
Imatinib
Tamoxifen
Doxorubicin
Bevacizumab
G2
M
G1
S
G0
tyrosine kinases
DNA synthesis
topoisomerase I
CDK2
tubulin
polymerisation/
depolymerisation
Vinca alkaloids*
taxol/taxotere
halichondrin*
spongistatin*
rhizoxin*
cryptophycin
sarcodictyin
eleutherobin
epothilones
discodermolide
D-24851 ?
dolastatin*
combretastatin*
camptothecin
CDK4
flavopiridol
(R)-roscovitine (CYC202)
paullones, indirubins
gleevec
iressa
OSI774
hydroxyurea
cytarabine
antifolates
5-fluorouracil
6-mercaptopurine
nitrogen mustards
nitrosoureas
mitomycin C
CDK1
Chk1
Chk2
UCN-01, SB-218078
debromohymenialdisine
isogranulatimide
AhR
actin
kinesin Eg5
monastrol
ecteinascidin 743
podophyllotoxin,doxorubicin
etoposide, mitoxantrone
topoisomerase II
ATM/ATR
R115777
SCH66336
ROCK
Y-27632
CDC25
DF203
FK317 HMGA
Plk1
Aurora
wortmanni
n
caffeine
ODC/SAMDC
Pin1
GSK-3
Cdc7
nucleotide excision
repair
Raf cytochalasins
latrunculin A
scytophycins
dolastatin 11
jasplakinolide
paullones, indirubins
(R)-roscovitine (CYC202)
paullones, indirubins
BAY-43-9006
fumagillin,TNP-470
PRIMA-1, pifithrin a
rapamycin mTOR/FRAP
PS-341 proteasome
bryostatin,
PKC412
PKC
histone deacetylasetrichostatin,
FK228
HSP90geldanamycin, 17-
AAGATK, MAFP cytosolic phospholipase A2
hexadecylphosphocholin
e
phospholipase D
CT-2584 choline
kinase
MEK1/Erk-1/2
PD98059, U0126
menadione
(K3)
farnesyl transferase
phosphatasesokadaic acid, fostreicin, calyculin A
Wee1
PD0166285
polyamine analogues
Pin1
p53/MDM2
Source: Cell cycle laboratory, L. Meijer, Roscoff, France
~80 drugs and drug candidates
Cancer chemotherapy is based on cell cycle arrest
CAUSES OF FAILURE IN DRUG
DEVELOPMENT
ADME
ANIMAL TOXICITY
LACK OF EFFICACY
ADVERSE EFFECTS
IN HUMANS
More than 50% of this failure can be predicted computationally in 2011
In 2061: six sigma will be achieved in silico
WET LAB: High-throughput screening (HTS)WET LAB: High-throughput screening (HTS)
Experimental techniqueExperimental technique
384-well microplates, florescence-based detection &384-well microplates, florescence-based detection &
desktop robotsdesktop robots
Up to 1M compounds per targetUp to 1M compounds per target
DRY LAB: Virtual screening (VS)DRY LAB: Virtual screening (VS)
Ligand-based methodsLigand-based methods
2D structures, substructures, fingerprints2D structures, substructures, fingerprints
Volume/surface matchingVolume/surface matching
3D pharmacophores, fingerprints3D pharmacophores, fingerprints
Receptor-based methodsReceptor-based methods
DockingDocking
Even 100B compounds per target triedEven 100B compounds per target tried
Receptor flexibility
OUR 1024-PROCESSOR HPC CLUSTER
WE ALSO USE 500 PROCESSORS FROM
WEST-GRID AND SHARCNET
Target-Protein Structure
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTV
IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFT
SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNL
NRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMV
KCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCM
LSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGE
EY
Primary: amino acid
sequence
Secondary: -helix and -α β
sheet
Tertiary: 3D-folding
Quaternary:
multimeric
arrangement
Molecular Dynamics
• Treats molecules
classically:
– Point charges and
masses
– Spring-like bonds
– Numerical integration of
equations of motion
Drug binding sites in tubulin
 Of the more thanOf the more than 100100 approvedapproved
cancer chemotherapy drugs oncancer chemotherapy drugs on
the market, approximately 15%the market, approximately 15%
target tubulin directly.target tubulin directly.
 None are specific for cancerNone are specific for cancer
cells, hence associated sidecells, hence associated side
effectseffects
Drug / Ligand
Protein
Drug ActionDrug Action: Inhibition of Protein-: Inhibition of Protein-
Protein InteractionsProtein Interactions
Cavity
Cavity
Cavity
The computational toolboxThe computational toolbox
The three-fold way:The three-fold way:
rational design andrational design and in silicoin silico testing of derivatives of knowntesting of derivatives of known
agentsagents
brute-force computational search using existing librariesbrute-force computational search using existing libraries
(pharma-matrix)(pharma-matrix)
De novo design from common pharmacophores for bestDe novo design from common pharmacophores for best
space filling propertiesspace filling properties
a pocketome data banka pocketome data bank
Reverse docking allows to predict side effectsReverse docking allows to predict side effects
How Do We Solve Our Puzzles?
ContentsContents
Compound dataCompound data sourcessources (PubChem, Zinc, NCI, SciFinder(PubChem, Zinc, NCI, SciFinder
~65M compounds)~65M compounds)
Drug dataDrug data sourcessources (DrugBank, Orange Book, CMC, WDI,(DrugBank, Orange Book, CMC, WDI,
MDDR ~ 250 k drugs)MDDR ~ 250 k drugs)
Molecular dataMolecular data toolkitstoolkits (OpenEye, Open Babel)(OpenEye, Open Babel)
Computational MethodsComputational Methods (MM, MD, QMMM)(MM, MD, QMMM)
Molecule file formatsMolecule file formats (PDB, Smilies )(PDB, Smilies )
DockingDocking (Autodock, Dock)(Autodock, Dock) ParallelParallel (Dovis)(Dovis)
Pharma-matrix apps:Pharma-matrix apps: eRxeRx
100 million targets (100,000 proteins x 100 pockets x 10 mutants):100 million targets (100,000 proteins x 100 pockets x 10 mutants):
pocketomepocketome
100 billion chemical compounds100 billion chemical compounds
10101919
potential interactions (filtering)potential interactions (filtering)
Hand-in-glove match by brute computational screeningHand-in-glove match by brute computational screening
pharmagooglepharmagoogle
Pocketome generation
(pocket clustering)
104
clusters 104
pockets
in a cluster
Docking
(1012
calculations within blocks)
Docking
(1012
calculations within blocks)
Personalized eDx and eRx
in a few decades a personal genome will cost $10 and
will be our ID at birth included in our eRx app
The Virtual Human:The Virtual Human:
Multi-Scale ModelingMulti-Scale Modeling
lobule
liver
whole body
hepatocyte
Drug molecules Interaction matrix

Más contenido relacionado

La actualidad más candente

Bioinformatics t9-t10-biocheminformatics v2014
Bioinformatics t9-t10-biocheminformatics v2014Bioinformatics t9-t10-biocheminformatics v2014
Bioinformatics t9-t10-biocheminformatics v2014Prof. Wim Van Criekinge
 
Webinar - Imaging technologies to visualise drug discovery
Webinar - Imaging technologies to visualise drug discoveryWebinar - Imaging technologies to visualise drug discovery
Webinar - Imaging technologies to visualise drug discoveryMedicines Discovery Catapult
 
Jax bio dataworldcongress.ngs.20181128finalwithoutbu
Jax bio dataworldcongress.ngs.20181128finalwithoutbuJax bio dataworldcongress.ngs.20181128finalwithoutbu
Jax bio dataworldcongress.ngs.20181128finalwithoutbuAnne Deslattes Mays
 
Illumina-General-Overview-Q1-17
Illumina-General-Overview-Q1-17Illumina-General-Overview-Q1-17
Illumina-General-Overview-Q1-17Matthew Holguin
 
Aug2015 horizon diagnostics
Aug2015 horizon diagnosticsAug2015 horizon diagnostics
Aug2015 horizon diagnosticsGenomeInABottle
 
MongoDB and the Connectivity Map: Making Connections Between Genetics and Dis...
MongoDB and the Connectivity Map: Making Connections Between Genetics and Dis...MongoDB and the Connectivity Map: Making Connections Between Genetics and Dis...
MongoDB and the Connectivity Map: Making Connections Between Genetics and Dis...MongoDB
 
Aug2015 Ali Bashir and Jason Chin Pac bio giab_assembly_summary_ali3
Aug2015 Ali Bashir and Jason Chin Pac bio giab_assembly_summary_ali3Aug2015 Ali Bashir and Jason Chin Pac bio giab_assembly_summary_ali3
Aug2015 Ali Bashir and Jason Chin Pac bio giab_assembly_summary_ali3GenomeInABottle
 
Bioinformatics and NGS for advancing in hearing loss research
Bioinformatics and NGS for advancing in hearing loss researchBioinformatics and NGS for advancing in hearing loss research
Bioinformatics and NGS for advancing in hearing loss researchJoaquin Dopazo
 
Addressing the growing demand for CNV and UPD detection
Addressing the growing demand for CNV and UPD detection Addressing the growing demand for CNV and UPD detection
Addressing the growing demand for CNV and UPD detection Oxford Gene Technology
 
HDx™ Reference Standards and Reference Materials for Next Generation Sequenci...
HDx™ Reference Standards and Reference Materials for Next Generation Sequenci...HDx™ Reference Standards and Reference Materials for Next Generation Sequenci...
HDx™ Reference Standards and Reference Materials for Next Generation Sequenci...Candy Smellie
 
Trans Code Therapeutics Investor Presentation 2022
Trans Code Therapeutics Investor Presentation 2022Trans Code Therapeutics Investor Presentation 2022
Trans Code Therapeutics Investor Presentation 2022RedChip Companies, Inc.
 
Next-Generation Sequencing Commercial Milestones Infographic
Next-Generation Sequencing Commercial Milestones InfographicNext-Generation Sequencing Commercial Milestones Infographic
Next-Generation Sequencing Commercial Milestones InfographicQIAGEN
 
Free webinar-introduction to bioinformatics - biologist-1
Free webinar-introduction to bioinformatics - biologist-1Free webinar-introduction to bioinformatics - biologist-1
Free webinar-introduction to bioinformatics - biologist-1Elia Brodsky
 
Big Data and Genomic Medicine by Corey Nislow
Big Data and Genomic Medicine by Corey NislowBig Data and Genomic Medicine by Corey Nislow
Big Data and Genomic Medicine by Corey NislowKnome_Inc
 
MDC Connects: Challenges of Opportunities of Complex Cell Models for Toxicity...
MDC Connects: Challenges of Opportunities of Complex Cell Models for Toxicity...MDC Connects: Challenges of Opportunities of Complex Cell Models for Toxicity...
MDC Connects: Challenges of Opportunities of Complex Cell Models for Toxicity...Medicines Discovery Catapult
 
How can Whole Genome Sequencing information be used to address data requireme...
How can Whole Genome Sequencing information be used to address data requireme...How can Whole Genome Sequencing information be used to address data requireme...
How can Whole Genome Sequencing information be used to address data requireme...OECD Environment
 
Bioinformatica 15-12-2011-t9-t10-bio cheminformatics
Bioinformatica 15-12-2011-t9-t10-bio cheminformaticsBioinformatica 15-12-2011-t9-t10-bio cheminformatics
Bioinformatica 15-12-2011-t9-t10-bio cheminformaticsProf. Wim Van Criekinge
 

La actualidad más candente (20)

Bioinformatics t9-t10-biocheminformatics v2014
Bioinformatics t9-t10-biocheminformatics v2014Bioinformatics t9-t10-biocheminformatics v2014
Bioinformatics t9-t10-biocheminformatics v2014
 
Jan2016 horizon GIAB
Jan2016 horizon GIABJan2016 horizon GIAB
Jan2016 horizon GIAB
 
Webinar - Imaging technologies to visualise drug discovery
Webinar - Imaging technologies to visualise drug discoveryWebinar - Imaging technologies to visualise drug discovery
Webinar - Imaging technologies to visualise drug discovery
 
Jax bio dataworldcongress.ngs.20181128finalwithoutbu
Jax bio dataworldcongress.ngs.20181128finalwithoutbuJax bio dataworldcongress.ngs.20181128finalwithoutbu
Jax bio dataworldcongress.ngs.20181128finalwithoutbu
 
Illumina-General-Overview-Q1-17
Illumina-General-Overview-Q1-17Illumina-General-Overview-Q1-17
Illumina-General-Overview-Q1-17
 
Aug2015 horizon diagnostics
Aug2015 horizon diagnosticsAug2015 horizon diagnostics
Aug2015 horizon diagnostics
 
MongoDB and the Connectivity Map: Making Connections Between Genetics and Dis...
MongoDB and the Connectivity Map: Making Connections Between Genetics and Dis...MongoDB and the Connectivity Map: Making Connections Between Genetics and Dis...
MongoDB and the Connectivity Map: Making Connections Between Genetics and Dis...
 
Aug2015 Ali Bashir and Jason Chin Pac bio giab_assembly_summary_ali3
Aug2015 Ali Bashir and Jason Chin Pac bio giab_assembly_summary_ali3Aug2015 Ali Bashir and Jason Chin Pac bio giab_assembly_summary_ali3
Aug2015 Ali Bashir and Jason Chin Pac bio giab_assembly_summary_ali3
 
Bioinformatics and NGS for advancing in hearing loss research
Bioinformatics and NGS for advancing in hearing loss researchBioinformatics and NGS for advancing in hearing loss research
Bioinformatics and NGS for advancing in hearing loss research
 
Addressing the growing demand for CNV and UPD detection
Addressing the growing demand for CNV and UPD detection Addressing the growing demand for CNV and UPD detection
Addressing the growing demand for CNV and UPD detection
 
HDx™ Reference Standards and Reference Materials for Next Generation Sequenci...
HDx™ Reference Standards and Reference Materials for Next Generation Sequenci...HDx™ Reference Standards and Reference Materials for Next Generation Sequenci...
HDx™ Reference Standards and Reference Materials for Next Generation Sequenci...
 
Trans Code Therapeutics Investor Presentation 2022
Trans Code Therapeutics Investor Presentation 2022Trans Code Therapeutics Investor Presentation 2022
Trans Code Therapeutics Investor Presentation 2022
 
Next-Generation Sequencing Commercial Milestones Infographic
Next-Generation Sequencing Commercial Milestones InfographicNext-Generation Sequencing Commercial Milestones Infographic
Next-Generation Sequencing Commercial Milestones Infographic
 
Free webinar-introduction to bioinformatics - biologist-1
Free webinar-introduction to bioinformatics - biologist-1Free webinar-introduction to bioinformatics - biologist-1
Free webinar-introduction to bioinformatics - biologist-1
 
2015 03 13_puurs_v_public
2015 03 13_puurs_v_public2015 03 13_puurs_v_public
2015 03 13_puurs_v_public
 
Big Data and Genomic Medicine by Corey Nislow
Big Data and Genomic Medicine by Corey NislowBig Data and Genomic Medicine by Corey Nislow
Big Data and Genomic Medicine by Corey Nislow
 
MDC Connects: Challenges of Opportunities of Complex Cell Models for Toxicity...
MDC Connects: Challenges of Opportunities of Complex Cell Models for Toxicity...MDC Connects: Challenges of Opportunities of Complex Cell Models for Toxicity...
MDC Connects: Challenges of Opportunities of Complex Cell Models for Toxicity...
 
How can Whole Genome Sequencing information be used to address data requireme...
How can Whole Genome Sequencing information be used to address data requireme...How can Whole Genome Sequencing information be used to address data requireme...
How can Whole Genome Sequencing information be used to address data requireme...
 
Bioinformatica 15-12-2011-t9-t10-bio cheminformatics
Bioinformatica 15-12-2011-t9-t10-bio cheminformaticsBioinformatica 15-12-2011-t9-t10-bio cheminformatics
Bioinformatica 15-12-2011-t9-t10-bio cheminformatics
 
Maha cv-linkedin-03 June,2015
Maha cv-linkedin-03 June,2015Maha cv-linkedin-03 June,2015
Maha cv-linkedin-03 June,2015
 

Similar a Jack Tuszynski Accelerating Chemotherapy Drug Discovery with Analytics and High Performance Computing

Drug Discovery Today: Fighting TB with Technology
Drug Discovery Today: Fighting TB with TechnologyDrug Discovery Today: Fighting TB with Technology
Drug Discovery Today: Fighting TB with Technologyrendevilla
 
Bigger Data to Increase Drug Discovery
Bigger Data to Increase Drug DiscoveryBigger Data to Increase Drug Discovery
Bigger Data to Increase Drug DiscoverySean Ekins
 
Quantitative Medicine Feb 2009
Quantitative Medicine Feb 2009Quantitative Medicine Feb 2009
Quantitative Medicine Feb 2009Ian Foster
 
acs talk open source drug discovery
acs talk open source drug discoveryacs talk open source drug discovery
acs talk open source drug discoverySean Ekins
 
2015-04-28 Open PHACTS at Swedish Linked Data Network Meet-up
2015-04-28 Open PHACTS at Swedish Linked Data Network Meet-up2015-04-28 Open PHACTS at Swedish Linked Data Network Meet-up
2015-04-28 Open PHACTS at Swedish Linked Data Network Meet-upopen_phacts
 
Multiplexing analysis of 1000 approved drugs in PubChem
Multiplexing analysis of 1000 approved drugs in PubChemMultiplexing analysis of 1000 approved drugs in PubChem
Multiplexing analysis of 1000 approved drugs in PubChemChris Southan
 
INFORMATICS 2.pptx
INFORMATICS 2.pptxINFORMATICS 2.pptx
INFORMATICS 2.pptxOramadevi1
 
Mashing Up Drug Discovery
Mashing Up Drug DiscoveryMashing Up Drug Discovery
Mashing Up Drug DiscoverySciBite Limited
 
Big Data in Pharma - Overview and Use Cases
Big Data in Pharma - Overview and Use CasesBig Data in Pharma - Overview and Use Cases
Big Data in Pharma - Overview and Use CasesJosef Scheiber
 
2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europe2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europeopen_phacts
 
Promiscuous patterns and perils in PubChem and the MLSCN
Promiscuous patterns and perils in PubChem and the MLSCNPromiscuous patterns and perils in PubChem and the MLSCN
Promiscuous patterns and perils in PubChem and the MLSCNJeremy Yang
 
2011-11-28 Open PHACTS at RSC CICAG
2011-11-28 Open PHACTS at RSC CICAG2011-11-28 Open PHACTS at RSC CICAG
2011-11-28 Open PHACTS at RSC CICAGopen_phacts
 
Next-Gen Drug Discovery: An Integrated Micro-Droplet Based Platform
Next-Gen Drug Discovery: An Integrated Micro-Droplet Based PlatformNext-Gen Drug Discovery: An Integrated Micro-Droplet Based Platform
Next-Gen Drug Discovery: An Integrated Micro-Droplet Based PlatformLaura Berry
 
Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013
Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013
Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013Prof. Wim Van Criekinge
 
Computer aided drug designing (CADD)
Computer aided drug designing (CADD)Computer aided drug designing (CADD)
Computer aided drug designing (CADD)Aakshay Subramaniam
 
Centre for Genomic Regulation Talk February 2024.pptx
Centre for Genomic Regulation Talk February 2024.pptxCentre for Genomic Regulation Talk February 2024.pptx
Centre for Genomic Regulation Talk February 2024.pptxNick Brown
 

Similar a Jack Tuszynski Accelerating Chemotherapy Drug Discovery with Analytics and High Performance Computing (20)

Drug Discovery Today: Fighting TB with Technology
Drug Discovery Today: Fighting TB with TechnologyDrug Discovery Today: Fighting TB with Technology
Drug Discovery Today: Fighting TB with Technology
 
Bigger Data to Increase Drug Discovery
Bigger Data to Increase Drug DiscoveryBigger Data to Increase Drug Discovery
Bigger Data to Increase Drug Discovery
 
Practical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS projectPractical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS project
 
Quantitative Medicine Feb 2009
Quantitative Medicine Feb 2009Quantitative Medicine Feb 2009
Quantitative Medicine Feb 2009
 
acs talk open source drug discovery
acs talk open source drug discoveryacs talk open source drug discovery
acs talk open source drug discovery
 
2015-04-28 Open PHACTS at Swedish Linked Data Network Meet-up
2015-04-28 Open PHACTS at Swedish Linked Data Network Meet-up2015-04-28 Open PHACTS at Swedish Linked Data Network Meet-up
2015-04-28 Open PHACTS at Swedish Linked Data Network Meet-up
 
Multiplexing analysis of 1000 approved drugs in PubChem
Multiplexing analysis of 1000 approved drugs in PubChemMultiplexing analysis of 1000 approved drugs in PubChem
Multiplexing analysis of 1000 approved drugs in PubChem
 
Biospace Libraries
Biospace LibrariesBiospace Libraries
Biospace Libraries
 
INFORMATICS 2.pptx
INFORMATICS 2.pptxINFORMATICS 2.pptx
INFORMATICS 2.pptx
 
INFORMATICS 2.pptx
INFORMATICS 2.pptxINFORMATICS 2.pptx
INFORMATICS 2.pptx
 
Mashing Up Drug Discovery
Mashing Up Drug DiscoveryMashing Up Drug Discovery
Mashing Up Drug Discovery
 
Big Data in Pharma - Overview and Use Cases
Big Data in Pharma - Overview and Use CasesBig Data in Pharma - Overview and Use Cases
Big Data in Pharma - Overview and Use Cases
 
2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europe2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europe
 
Promiscuous patterns and perils in PubChem and the MLSCN
Promiscuous patterns and perils in PubChem and the MLSCNPromiscuous patterns and perils in PubChem and the MLSCN
Promiscuous patterns and perils in PubChem and the MLSCN
 
Sourcing high quality online data resources for computational toxicology
Sourcing high quality online data resources for computational toxicologySourcing high quality online data resources for computational toxicology
Sourcing high quality online data resources for computational toxicology
 
2011-11-28 Open PHACTS at RSC CICAG
2011-11-28 Open PHACTS at RSC CICAG2011-11-28 Open PHACTS at RSC CICAG
2011-11-28 Open PHACTS at RSC CICAG
 
Next-Gen Drug Discovery: An Integrated Micro-Droplet Based Platform
Next-Gen Drug Discovery: An Integrated Micro-Droplet Based PlatformNext-Gen Drug Discovery: An Integrated Micro-Droplet Based Platform
Next-Gen Drug Discovery: An Integrated Micro-Droplet Based Platform
 
Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013
Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013
Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013
 
Computer aided drug designing (CADD)
Computer aided drug designing (CADD)Computer aided drug designing (CADD)
Computer aided drug designing (CADD)
 
Centre for Genomic Regulation Talk February 2024.pptx
Centre for Genomic Regulation Talk February 2024.pptxCentre for Genomic Regulation Talk February 2024.pptx
Centre for Genomic Regulation Talk February 2024.pptx
 

Más de Kim Solez ,

Kim Solez The Ethics of Pig to Human Transplants, Artificial Intelligence, an...
Kim Solez The Ethics of Pig to Human Transplants, Artificial Intelligence, an...Kim Solez The Ethics of Pig to Human Transplants, Artificial Intelligence, an...
Kim Solez The Ethics of Pig to Human Transplants, Artificial Intelligence, an...Kim Solez ,
 
Kim Solez The Interesting Next Sixty Days of AI Jan 3 to March 2 2023 in Path...
Kim Solez The Interesting Next Sixty Days of AI Jan 3 to March 2 2023 in Path...Kim Solez The Interesting Next Sixty Days of AI Jan 3 to March 2 2023 in Path...
Kim Solez The Interesting Next Sixty Days of AI Jan 3 to March 2 2023 in Path...Kim Solez ,
 
Kim Solez FINAL Whatever You Can Do, Or Dream You Can, Begin It- Report from ...
Kim Solez FINAL Whatever You Can Do, Or Dream You Can, Begin It- Report from ...Kim Solez FINAL Whatever You Can Do, Or Dream You Can, Begin It- Report from ...
Kim Solez FINAL Whatever You Can Do, Or Dream You Can, Begin It- Report from ...Kim Solez ,
 
Kim Solez DALL-E and Kidney Pathology Machine Fantasies Give Hint About What...
Kim Solez DALL-E  and Kidney Pathology Machine Fantasies Give Hint About What...Kim Solez DALL-E  and Kidney Pathology Machine Fantasies Give Hint About What...
Kim Solez DALL-E and Kidney Pathology Machine Fantasies Give Hint About What...Kim Solez ,
 
Kim Solez How AI can improve human cooperation AI Seminar August 5 2022.pptx
Kim Solez How AI can improve human cooperation AI Seminar August 5 2022.pptxKim Solez How AI can improve human cooperation AI Seminar August 5 2022.pptx
Kim Solez How AI can improve human cooperation AI Seminar August 5 2022.pptxKim Solez ,
 
Kim Solez Clinical Trials, Fundamental DIscoveries and Teaching Renal Transpl...
Kim Solez Clinical Trials, Fundamental DIscoveries and Teaching Renal Transpl...Kim Solez Clinical Trials, Fundamental DIscoveries and Teaching Renal Transpl...
Kim Solez Clinical Trials, Fundamental DIscoveries and Teaching Renal Transpl...Kim Solez ,
 
Kim Solez How AI can improve human cooperation through suggesting followup ac...
Kim Solez How AI can improve human cooperation through suggesting followup ac...Kim Solez How AI can improve human cooperation through suggesting followup ac...
Kim Solez How AI can improve human cooperation through suggesting followup ac...Kim Solez ,
 
Kim Solez How AI can improve human cooperation through suggesting followup ac...
Kim Solez How AI can improve human cooperation through suggesting followup ac...Kim Solez How AI can improve human cooperation through suggesting followup ac...
Kim Solez How AI can improve human cooperation through suggesting followup ac...Kim Solez ,
 
Kim Solez 2022 TRM COP - ATC Slide Deck1. pptx
Kim Solez 2022 TRM COP - ATC Slide Deck1. pptxKim Solez 2022 TRM COP - ATC Slide Deck1. pptx
Kim Solez 2022 TRM COP - ATC Slide Deck1. pptxKim Solez ,
 
Kim Solez Xenotransplantation- The Rest of the Story April 8 2022 6.pptx
Kim Solez Xenotransplantation- The Rest of the Story April 8 2022 6.pptxKim Solez Xenotransplantation- The Rest of the Story April 8 2022 6.pptx
Kim Solez Xenotransplantation- The Rest of the Story April 8 2022 6.pptxKim Solez ,
 
Kim Solez Hooking-Up Physical Forces Optimism and Dark Energy Presentation Se...
Kim Solez Hooking-Up Physical Forces Optimism and Dark Energy Presentation Se...Kim Solez Hooking-Up Physical Forces Optimism and Dark Energy Presentation Se...
Kim Solez Hooking-Up Physical Forces Optimism and Dark Energy Presentation Se...Kim Solez ,
 
Kim Solez Boundaries and Ethics of cyberNephrology Feb 2009 boundaries ethics 2
Kim Solez Boundaries and Ethics of cyberNephrology Feb 2009 boundaries ethics 2Kim Solez Boundaries and Ethics of cyberNephrology Feb 2009 boundaries ethics 2
Kim Solez Boundaries and Ethics of cyberNephrology Feb 2009 boundaries ethics 2Kim Solez ,
 
Kim Solez combining resources in tx and regen med make no small plans
Kim Solez combining resources in tx and regen med make no small plansKim Solez combining resources in tx and regen med make no small plans
Kim Solez combining resources in tx and regen med make no small plansKim Solez ,
 
Solez Yagi Farris Barisoni Digital transplant pathology white paper2
Solez Yagi Farris Barisoni Digital transplant pathology white paper2Solez Yagi Farris Barisoni Digital transplant pathology white paper2
Solez Yagi Farris Barisoni Digital transplant pathology white paper2Kim Solez ,
 
Kim Solez Yukako Yagi Digital transplant pathology white paper1
Kim Solez Yukako Yagi Digital transplant pathology white paper1Kim Solez Yukako Yagi Digital transplant pathology white paper1
Kim Solez Yukako Yagi Digital transplant pathology white paper1Kim Solez ,
 
Kim Solez Yukako Yagi Digital transplant pathology white paper
Kim Solez Yukako Yagi Digital transplant pathology white paperKim Solez Yukako Yagi Digital transplant pathology white paper
Kim Solez Yukako Yagi Digital transplant pathology white paperKim Solez ,
 
Kim Solez 384 years of banff spirit new june 26 2019
Kim Solez 384 years of banff spirit new june 26 2019Kim Solez 384 years of banff spirit new june 26 2019
Kim Solez 384 years of banff spirit new june 26 2019Kim Solez ,
 
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part II
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part IIKim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part II
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part IIKim Solez ,
 
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part I
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part IKim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part I
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part IKim Solez ,
 
Kim Solez shortened slide set for opening reception Pittsburgh Banff meeting
Kim Solez shortened slide set for opening reception Pittsburgh Banff meetingKim Solez shortened slide set for opening reception Pittsburgh Banff meeting
Kim Solez shortened slide set for opening reception Pittsburgh Banff meetingKim Solez ,
 

Más de Kim Solez , (20)

Kim Solez The Ethics of Pig to Human Transplants, Artificial Intelligence, an...
Kim Solez The Ethics of Pig to Human Transplants, Artificial Intelligence, an...Kim Solez The Ethics of Pig to Human Transplants, Artificial Intelligence, an...
Kim Solez The Ethics of Pig to Human Transplants, Artificial Intelligence, an...
 
Kim Solez The Interesting Next Sixty Days of AI Jan 3 to March 2 2023 in Path...
Kim Solez The Interesting Next Sixty Days of AI Jan 3 to March 2 2023 in Path...Kim Solez The Interesting Next Sixty Days of AI Jan 3 to March 2 2023 in Path...
Kim Solez The Interesting Next Sixty Days of AI Jan 3 to March 2 2023 in Path...
 
Kim Solez FINAL Whatever You Can Do, Or Dream You Can, Begin It- Report from ...
Kim Solez FINAL Whatever You Can Do, Or Dream You Can, Begin It- Report from ...Kim Solez FINAL Whatever You Can Do, Or Dream You Can, Begin It- Report from ...
Kim Solez FINAL Whatever You Can Do, Or Dream You Can, Begin It- Report from ...
 
Kim Solez DALL-E and Kidney Pathology Machine Fantasies Give Hint About What...
Kim Solez DALL-E  and Kidney Pathology Machine Fantasies Give Hint About What...Kim Solez DALL-E  and Kidney Pathology Machine Fantasies Give Hint About What...
Kim Solez DALL-E and Kidney Pathology Machine Fantasies Give Hint About What...
 
Kim Solez How AI can improve human cooperation AI Seminar August 5 2022.pptx
Kim Solez How AI can improve human cooperation AI Seminar August 5 2022.pptxKim Solez How AI can improve human cooperation AI Seminar August 5 2022.pptx
Kim Solez How AI can improve human cooperation AI Seminar August 5 2022.pptx
 
Kim Solez Clinical Trials, Fundamental DIscoveries and Teaching Renal Transpl...
Kim Solez Clinical Trials, Fundamental DIscoveries and Teaching Renal Transpl...Kim Solez Clinical Trials, Fundamental DIscoveries and Teaching Renal Transpl...
Kim Solez Clinical Trials, Fundamental DIscoveries and Teaching Renal Transpl...
 
Kim Solez How AI can improve human cooperation through suggesting followup ac...
Kim Solez How AI can improve human cooperation through suggesting followup ac...Kim Solez How AI can improve human cooperation through suggesting followup ac...
Kim Solez How AI can improve human cooperation through suggesting followup ac...
 
Kim Solez How AI can improve human cooperation through suggesting followup ac...
Kim Solez How AI can improve human cooperation through suggesting followup ac...Kim Solez How AI can improve human cooperation through suggesting followup ac...
Kim Solez How AI can improve human cooperation through suggesting followup ac...
 
Kim Solez 2022 TRM COP - ATC Slide Deck1. pptx
Kim Solez 2022 TRM COP - ATC Slide Deck1. pptxKim Solez 2022 TRM COP - ATC Slide Deck1. pptx
Kim Solez 2022 TRM COP - ATC Slide Deck1. pptx
 
Kim Solez Xenotransplantation- The Rest of the Story April 8 2022 6.pptx
Kim Solez Xenotransplantation- The Rest of the Story April 8 2022 6.pptxKim Solez Xenotransplantation- The Rest of the Story April 8 2022 6.pptx
Kim Solez Xenotransplantation- The Rest of the Story April 8 2022 6.pptx
 
Kim Solez Hooking-Up Physical Forces Optimism and Dark Energy Presentation Se...
Kim Solez Hooking-Up Physical Forces Optimism and Dark Energy Presentation Se...Kim Solez Hooking-Up Physical Forces Optimism and Dark Energy Presentation Se...
Kim Solez Hooking-Up Physical Forces Optimism and Dark Energy Presentation Se...
 
Kim Solez Boundaries and Ethics of cyberNephrology Feb 2009 boundaries ethics 2
Kim Solez Boundaries and Ethics of cyberNephrology Feb 2009 boundaries ethics 2Kim Solez Boundaries and Ethics of cyberNephrology Feb 2009 boundaries ethics 2
Kim Solez Boundaries and Ethics of cyberNephrology Feb 2009 boundaries ethics 2
 
Kim Solez combining resources in tx and regen med make no small plans
Kim Solez combining resources in tx and regen med make no small plansKim Solez combining resources in tx and regen med make no small plans
Kim Solez combining resources in tx and regen med make no small plans
 
Solez Yagi Farris Barisoni Digital transplant pathology white paper2
Solez Yagi Farris Barisoni Digital transplant pathology white paper2Solez Yagi Farris Barisoni Digital transplant pathology white paper2
Solez Yagi Farris Barisoni Digital transplant pathology white paper2
 
Kim Solez Yukako Yagi Digital transplant pathology white paper1
Kim Solez Yukako Yagi Digital transplant pathology white paper1Kim Solez Yukako Yagi Digital transplant pathology white paper1
Kim Solez Yukako Yagi Digital transplant pathology white paper1
 
Kim Solez Yukako Yagi Digital transplant pathology white paper
Kim Solez Yukako Yagi Digital transplant pathology white paperKim Solez Yukako Yagi Digital transplant pathology white paper
Kim Solez Yukako Yagi Digital transplant pathology white paper
 
Kim Solez 384 years of banff spirit new june 26 2019
Kim Solez 384 years of banff spirit new june 26 2019Kim Solez 384 years of banff spirit new june 26 2019
Kim Solez 384 years of banff spirit new june 26 2019
 
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part II
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part IIKim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part II
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part II
 
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part I
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part IKim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part I
Kim Solez C3 GN case with 6-8 nm fibrils Congo Red negative Part I
 
Kim Solez shortened slide set for opening reception Pittsburgh Banff meeting
Kim Solez shortened slide set for opening reception Pittsburgh Banff meetingKim Solez shortened slide set for opening reception Pittsburgh Banff meeting
Kim Solez shortened slide set for opening reception Pittsburgh Banff meeting
 

Último

VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...jageshsingh5554
 
Call Girls Kochi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Kochi Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Kochi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Kochi Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...vidya singh
 
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...narwatsonia7
 
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Dipal Arora
 
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...hotbabesbook
 
Call Girls Bangalore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Bangalore Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Bangalore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Bangalore Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...Taniya Sharma
 
Call Girls Nagpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Nagpur Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Nagpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Nagpur Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Call Girls Tirupati Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Tirupati Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Tirupati Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Tirupati Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋TANUJA PANDEY
 
Call Girls Gwalior Just Call 8617370543 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 8617370543 Top Class Call Girl Service AvailableCall Girls Gwalior Just Call 8617370543 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 8617370543 Top Class Call Girl Service AvailableDipal Arora
 
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
VIP Call Girls Indore Kirti 💚😋 9256729539 🚀 Indore Escorts
VIP Call Girls Indore Kirti 💚😋  9256729539 🚀 Indore EscortsVIP Call Girls Indore Kirti 💚😋  9256729539 🚀 Indore Escorts
VIP Call Girls Indore Kirti 💚😋 9256729539 🚀 Indore Escortsaditipandeya
 
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...Arohi Goyal
 
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...narwatsonia7
 
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore EscortsCall Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escortsvidya singh
 
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...CALL GIRLS
 
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 

Último (20)

VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
 
Call Girls Kochi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Kochi Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Kochi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Kochi Just Call 9907093804 Top Class Call Girl Service Available
 
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
 
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
 
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
 
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
 
Call Girls Bangalore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Bangalore Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Bangalore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Bangalore Just Call 9907093804 Top Class Call Girl Service Available
 
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
 
Call Girls Nagpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Nagpur Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Nagpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Nagpur Just Call 9907093804 Top Class Call Girl Service Available
 
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
 
Call Girls Tirupati Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Tirupati Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Tirupati Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Tirupati Just Call 9907093804 Top Class Call Girl Service Available
 
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
 
Call Girls Gwalior Just Call 8617370543 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 8617370543 Top Class Call Girl Service AvailableCall Girls Gwalior Just Call 8617370543 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 8617370543 Top Class Call Girl Service Available
 
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
 
VIP Call Girls Indore Kirti 💚😋 9256729539 🚀 Indore Escorts
VIP Call Girls Indore Kirti 💚😋  9256729539 🚀 Indore EscortsVIP Call Girls Indore Kirti 💚😋  9256729539 🚀 Indore Escorts
VIP Call Girls Indore Kirti 💚😋 9256729539 🚀 Indore Escorts
 
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
 
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
 
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore EscortsCall Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
 
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
 
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
 

Jack Tuszynski Accelerating Chemotherapy Drug Discovery with Analytics and High Performance Computing

  • 1. Jack Tuszynski Cross Cancer Institute Department of Physics University of Alberta Edmonton, Canada http://www.phys.ualberta.ca/~jtus “Accelerating Chemotherapy Drug Discovery with High Performance Computing and Analytics”
  • 3. Modern Drug DevelopmentModern Drug Development Success Rate 1:100,000 !Success Rate 1:100,000 ! 00 22 44 66 88 1010 1212 1414 1616 DiscoveryDiscovery Preclinical testingPreclinical testing Phase IPhase I Phase IIPhase II Phase IIIPhase III ApprovalApproval Post marketPost market 100,000100,000 100100 55 11 Time in years Cost $1B
  • 4. Identify disease Isolate protein Find drug Preclinical testing GENOMICS, PROTEOMICS & BIOPHARM. HIGH THROUGHPUT SCREENING MOLECULAR MODELING VIRTUAL SCREENING COMBINATORIAL CHEMISTRY IN VITRO & IN SILICO ADME MODELS Potentially producing many more targets and “personalized” targets Screening up to 100,000 compounds a day for activity against a target protein Using a computer to predict activity Rapidly producing vast numbers of compounds Computer graphics & models help improve activity Tissue and computer models begin to replace animal testing VIRTUAL SCREENING MOLECULAR MODELING The Evolution in Drug Design and Development
  • 5. 5 Integration of biological dataIntegration of biological data impacts drug developmentimpacts drug development information stored in the genetic code (DNA)information stored in the genetic code (DNA) protein sequencesprotein sequences 3D structures of biomolecules3D structures of biomolecules experimental results from various sources (kd, IC50,experimental results from various sources (kd, IC50, expression)expression) clinical dataclinical data patient statisticspatient statistics scientific literaturescientific literature
  • 6. 6 ……and leads toand leads to computational explosioncomputational explosion An avalanche of data:An avalanche of data: SequencesSequences Functional relationsFunctional relations StructuresStructures This requiresThis requires computationalcomputational approachesapproaches • 100’s of completed genomes • 1000’s of known reactions • 10,000’s of known 3D structures • 100,000’s of protein-ligand interactions • 1,000,000’s of known proteins & enzymes • Decades of biological/chemical know-how • Computational & Mathematical resources The Push to Systems Biology
  • 7. 77 Key areas ofKey areas of bioinformaticsbioinformatics organisation of knowledge (sequences, structures, functional data) e.g. homology searches
  • 8. Specifically for drug discovery: PDB : 50,000 proteins + homologs 1500 targets (human proteins) Approx. 400 (80 in cancer) utilized Orange Book: 1800 medicinal drugs Drug Bank: 4900 drugs Cancer chemotherapy drugs: 103 Protein-drug interactions but also Protein-protein interactions
  • 9. Molecular Targets:Cancer Cell NetworkMolecular Targets:Cancer Cell Network A very complex but algorithmic system Based on a lock-and-key principle We will find keys to all these locks by 2061
  • 10. CANCER CHEMOTHERAPY DRUGS Approximately 100 standard chemotherapeutic drugs: 1)Alkylating agents: Genotoxic (20-25) 2) Plant alkaloids: Inhibition of mitosis (10-15) 3) Antimetabolites: Inhibition of base synthesis (15-20) 4) Antibiotics: Derived from Streptomyces (10-15) 5) Targeted antibodies: Bind cell surface receptors (5-10) 6) Hormones: Inhibit or stimulate hormone signaling (15-20) 7) Directly targeting small molecules 8)Other indirect effects: Angiogenesis or immune modulators (10-15) Number of current chemotherapy targets: 101 Number of chemotherapy drugs: 102 Potential Targets (Pharmacogenomics): 103 Paclitaxel Cisplatin Methotrexate Trastuzumab Imatinib Tamoxifen Doxorubicin Bevacizumab
  • 11. G2 M G1 S G0 tyrosine kinases DNA synthesis topoisomerase I CDK2 tubulin polymerisation/ depolymerisation Vinca alkaloids* taxol/taxotere halichondrin* spongistatin* rhizoxin* cryptophycin sarcodictyin eleutherobin epothilones discodermolide D-24851 ? dolastatin* combretastatin* camptothecin CDK4 flavopiridol (R)-roscovitine (CYC202) paullones, indirubins gleevec iressa OSI774 hydroxyurea cytarabine antifolates 5-fluorouracil 6-mercaptopurine nitrogen mustards nitrosoureas mitomycin C CDK1 Chk1 Chk2 UCN-01, SB-218078 debromohymenialdisine isogranulatimide AhR actin kinesin Eg5 monastrol ecteinascidin 743 podophyllotoxin,doxorubicin etoposide, mitoxantrone topoisomerase II ATM/ATR R115777 SCH66336 ROCK Y-27632 CDC25 DF203 FK317 HMGA Plk1 Aurora wortmanni n caffeine ODC/SAMDC Pin1 GSK-3 Cdc7 nucleotide excision repair Raf cytochalasins latrunculin A scytophycins dolastatin 11 jasplakinolide paullones, indirubins (R)-roscovitine (CYC202) paullones, indirubins BAY-43-9006 fumagillin,TNP-470 PRIMA-1, pifithrin a rapamycin mTOR/FRAP PS-341 proteasome bryostatin, PKC412 PKC histone deacetylasetrichostatin, FK228 HSP90geldanamycin, 17- AAGATK, MAFP cytosolic phospholipase A2 hexadecylphosphocholin e phospholipase D CT-2584 choline kinase MEK1/Erk-1/2 PD98059, U0126 menadione (K3) farnesyl transferase phosphatasesokadaic acid, fostreicin, calyculin A Wee1 PD0166285 polyamine analogues Pin1 p53/MDM2 Source: Cell cycle laboratory, L. Meijer, Roscoff, France ~80 drugs and drug candidates Cancer chemotherapy is based on cell cycle arrest
  • 12. CAUSES OF FAILURE IN DRUG DEVELOPMENT ADME ANIMAL TOXICITY LACK OF EFFICACY ADVERSE EFFECTS IN HUMANS More than 50% of this failure can be predicted computationally in 2011 In 2061: six sigma will be achieved in silico
  • 13. WET LAB: High-throughput screening (HTS)WET LAB: High-throughput screening (HTS) Experimental techniqueExperimental technique 384-well microplates, florescence-based detection &384-well microplates, florescence-based detection & desktop robotsdesktop robots Up to 1M compounds per targetUp to 1M compounds per target DRY LAB: Virtual screening (VS)DRY LAB: Virtual screening (VS) Ligand-based methodsLigand-based methods 2D structures, substructures, fingerprints2D structures, substructures, fingerprints Volume/surface matchingVolume/surface matching 3D pharmacophores, fingerprints3D pharmacophores, fingerprints Receptor-based methodsReceptor-based methods DockingDocking Even 100B compounds per target triedEven 100B compounds per target tried Receptor flexibility
  • 14. OUR 1024-PROCESSOR HPC CLUSTER WE ALSO USE 500 PROCESSORS FROM WEST-GRID AND SHARCNET
  • 16. Molecular Dynamics • Treats molecules classically: – Point charges and masses – Spring-like bonds – Numerical integration of equations of motion
  • 17. Drug binding sites in tubulin  Of the more thanOf the more than 100100 approvedapproved cancer chemotherapy drugs oncancer chemotherapy drugs on the market, approximately 15%the market, approximately 15% target tubulin directly.target tubulin directly.  None are specific for cancerNone are specific for cancer cells, hence associated sidecells, hence associated side effectseffects
  • 18. Drug / Ligand Protein Drug ActionDrug Action: Inhibition of Protein-: Inhibition of Protein- Protein InteractionsProtein Interactions Cavity Cavity Cavity
  • 19. The computational toolboxThe computational toolbox The three-fold way:The three-fold way: rational design andrational design and in silicoin silico testing of derivatives of knowntesting of derivatives of known agentsagents brute-force computational search using existing librariesbrute-force computational search using existing libraries (pharma-matrix)(pharma-matrix) De novo design from common pharmacophores for bestDe novo design from common pharmacophores for best space filling propertiesspace filling properties a pocketome data banka pocketome data bank Reverse docking allows to predict side effectsReverse docking allows to predict side effects
  • 20. How Do We Solve Our Puzzles?
  • 21. ContentsContents Compound dataCompound data sourcessources (PubChem, Zinc, NCI, SciFinder(PubChem, Zinc, NCI, SciFinder ~65M compounds)~65M compounds) Drug dataDrug data sourcessources (DrugBank, Orange Book, CMC, WDI,(DrugBank, Orange Book, CMC, WDI, MDDR ~ 250 k drugs)MDDR ~ 250 k drugs) Molecular dataMolecular data toolkitstoolkits (OpenEye, Open Babel)(OpenEye, Open Babel) Computational MethodsComputational Methods (MM, MD, QMMM)(MM, MD, QMMM) Molecule file formatsMolecule file formats (PDB, Smilies )(PDB, Smilies ) DockingDocking (Autodock, Dock)(Autodock, Dock) ParallelParallel (Dovis)(Dovis)
  • 22. Pharma-matrix apps:Pharma-matrix apps: eRxeRx 100 million targets (100,000 proteins x 100 pockets x 10 mutants):100 million targets (100,000 proteins x 100 pockets x 10 mutants): pocketomepocketome 100 billion chemical compounds100 billion chemical compounds 10101919 potential interactions (filtering)potential interactions (filtering) Hand-in-glove match by brute computational screeningHand-in-glove match by brute computational screening pharmagooglepharmagoogle
  • 23. Pocketome generation (pocket clustering) 104 clusters 104 pockets in a cluster Docking (1012 calculations within blocks) Docking (1012 calculations within blocks)
  • 24.
  • 25. Personalized eDx and eRx in a few decades a personal genome will cost $10 and will be our ID at birth included in our eRx app
  • 26. The Virtual Human:The Virtual Human: Multi-Scale ModelingMulti-Scale Modeling lobule liver whole body hepatocyte Drug molecules Interaction matrix

Notas del editor

  1. Let’s take a small part of the picture here. There many areas of research in this picture. In this presentation I will focus on these two subjects which are basically our research group interest.
  2. The problem is even worse. Proteins may undergo post-translational modifications, associations with other molecules or prosthetic groups, and formation of multimeric complexes. In medicine, a prosthesis (plural prostheses) is an artificial extension that replaces a missing body part. It is part of the field of biomechatronics, the science of fusing mechanical devices with human muscle, skeleton, and nervous systems to assist or enhance motor control lost by trauma, disease, or defect.
  3. Cisplating – crosslinks DNA Paclitaxel – binds tubulin and inhibits chromasome seggregation Methotrexate – inhibits folate synthesis Doxorubicin – DNA intercelator Trastuzumab – HER2 Tamoxifen – estrogen antagonist Imatinib Gleevec – tyrosine kinase inhibitor Bevacizumab - binds VEGF and inhibits angiogenesis
  4. -h-bonds -salt-bridges -hydrophobic, hydrophilic
  5. Here is a close up view of the secondary strucutre of tubulin as it is observed in a protofilament. Several drug binding sites have been characterized crystallographically. Shown as VDW spheres are three of the best characterized tubulin binding drugs, Taxol, vinblastine and colchicine. There are currently about 100 approved chemotharapy drugs on the market, several of which are monoclonal antibodies. Of these drugs, about 15% specifically target tubulin in some way reducing or increasing their dynamicity. Unfortunately, none of the tubulin binding chemotherapy drugs are specific for cancer cells. I will folcus on colchcine for this talk
  6. When the structure of the target protein is known, the drug discovery process usually follows a well-established procedure shown schematically in Figure 1. Virtual screening techniques are applied early during the docking protocol to reduce the size of large compound libraries. Initially, libraries are ‘‘pre-filtered’’ using a series of simple physicochemical descriptors to eliminate compounds not expected to be suitable drugs. Pharmacophore analysis, neural nets, similarity analysis, scaffold analysis, Lipinski’s rule of five. This procedure, which reduces the size of the library to a group of molecules more likely to bind the target receptor, is known as enrichment. Once an optimum library has been produced, molecules are docked to the target receptor to reduce further the number of candidates. This initial screening makes use of fast, but not very accurate, ranking functions to evaluate the relative stability of the docked complexes. The selected candidates, usually a few hundred, are subject to further docking experiments using more sophisticated scoring functions
  7. When the structure of the target protein is known, the drug discovery process usually follows a well-established procedure shown schematically in Figure 1. Virtual screening techniques are applied early during the docking protocol to reduce the size of large compound libraries. Initially, libraries are ‘‘pre-filtered’’ using a series of simple physicochemical descriptors to eliminate compounds not expected to be suitable drugs. Pharmacophore analysis, neural nets, similarity analysis, scaffold analysis, Lipinski’s rule of five. This procedure, which reduces the size of the library to a group of molecules more likely to bind the target receptor, is known as enrichment. Once an optimum library has been produced, molecules are docked to the target receptor to reduce further the number of candidates. This initial screening makes use of fast, but not very accurate, ranking functions to evaluate the relative stability of the docked complexes. The selected candidates, usually a few hundred, are subject to further docking experiments using more sophisticated scoring functions