SlideShare una empresa de Scribd logo
1 de 26
Descargar para leer sin conexión
Cloning, Expression, Purification and
    Enzymological Characterization of
NS2B/NS3 Protease / RNA Helicase protein of
       Japanese Encephalitis Virus.



                    Chakard Chalayut
     Advisor: Asst. Prof. Gerd Katzenmeier, Ph.D.
            Laboratory of Molecular Virology
       Institute of Molecular Biology & Genetics
Japanese Encephalitis Virus

-Flaviviridae family
-Mosquito-borne neurotropic
flavivirus
    •causes severe central
    nerve system diseases
Japanese Encephalitis Virus




Culex tritaeniorhynchus.




   Source : vietnammedicalpractice.com
                        Source: fehd.gov.hk
Japanese Encephalitis Virus
JEV causes severe
central nerve system
diseases such as


50,000 Cases
10,000
p o l i o mye l i t i s - l i ke
 30% fatality rate
acute flaccid paralysis,
aseptic meningitis and
encephalitis



                                   Source:wonder.cdc.gov

                             Source: cdc.gov
Prevention and treatment of
          JEV disease


       Drug                No drug exist


Vaccine development       Available vaccine


                      Elimination of mosquitoes
 Mosquitoes control        breeding places
Molecular biology of Japanese Encephalitis Virus




               Source : molecular-virology.uni-hd.de
The NS2B
  • 130 aa                         Hypothetical model
  • activating domain              NS2B-NS3 complex
      central hydrophilic region
      (Falgout et al, 1993)
  • 3 membrane spanning parts

     hydrophobicity plot



                                        ฺBrinkworth et al, 1999




51 DMWLERAADISWEMDAAITGSSRRLDVKLDDDGDFHLIDDPGVP 95
The NS3

                                 Protease

                                  NTPase


                             •Chymotrypsin-like fold
                             2-β barrel Helicase
                                 RNA domains
                             •Inactive alone
Theoretical model from PDB
                             •Enzyme’s pocket is small
            2I84
The NS3 protease
 Complexation with NS2B cofactor



                •
 conformational change serine protease
                     NS3
 alteration of the enzyme pocket
 additional substrate binding 20 kDa
                    domain site
                •catalytic residues His51,
                Asp75, Ser135
Background
• NS2B(H) JE - NS3p Den did not cleaved Den
  polyprotein but NS2B(H) Den - NS3p JE cleaved JEV
  polyprotein.

• The C-terminal portion of Den NS2B is required for
  interaction with Den NS3 to activate protease.

                              • Jan. L R et al, 1995
Background
• Ser  to Ile60 were essential region required for NS3
        46
  protease activity.
• Ala substition of Trp
                      50, Glu55, and Arg56
                                       in NS2B
  shown significantly reduced NS3 protease activity.




                               • Lin. C W et al,2007
Objective
•   to perform cloning of the NS2B-NS3 portion of the JEV
    polyprotein, express in E.coli and biochemically purify
    to determinants of clevage activity and cofactor
    requirement will be analyzed and compared to dengue
    virus.

•   The second objective is to study differences in
    substrate specificity and inhibitors by using peptide
    substrates incorporated with fluorogenic or
    chromogenic reported groups.
Method & Result
 pLS with NS2B-NS3 JEV

 NS2B(H)      NS3p

       SOE-PCR

     NS2B(H)-NS3p
NS2B(H)
      NS2B      NS3p   NS3




    NS2B(H)   NS3p
- Control

                            NS2B(H)

                                      NS2B(H)




                                                                             NS3 protease

                                                                                            NS3 protease

                                                                                                           NS3 protease
                                                                 - Control
                                                    1500


      1500                                          1000
                                                     900
                                                     800
      1000                                           700
       900
       800                                           600
       700                                           500
      600
                                                     400
      500
      400                                            300

      300

                                                     200

      200




Figure 1 : The PCR product NS2B(H) JEV amplified   Figure 2 : The PCR product NS3protease JEV
from NS2B-NS3 JEV (Lane 3 and 4). The size of      amplified from NS2B-NS3 JEV (Lane 3 to 5 ). The size
NS2B(H) was 187 bp.                                of NS3 protease was 594 bp.
NS2B(H)-NS3p




                                     - Control




                                                                                     NS2B(H)-NS3p
                                                                         - Control
                                                          1500

                                                           1000
                                                            900
1500                                                        800
                                                            700
                                                           600
1000
 900                                                       500
 800
                                                           400
700
600
                                                           300
500
400                                                        200
300


                                                           100




Figure 3 : The SOE-PCR product NS2B(H)-          Figure 4 : The NS2B(H)-NS3protease JEV
NS3protease JEV (Lane 2 to 5 ). The size of      (Lane 3 ) after digested with BamHI and KpnI.
NS2B(H)-NS3 protease was 765 bp.                 The size of NS2B(H)-NS3 protease was 765 bp.
Method & Result
pTrcHis Den with NS2B-NS3 Den

    NS2B(H)      NS3p

          SOE-PCR

      NS2B(H)-NS3p Den
NS3 protease


                                                                                                 NS3 protease
                                                                      - Control
                                      - Control
                  NS2B(H)

                            NS2B(H)
                                                           1500
       1500

                                                           1000
       1000                                                 900
        900                                                 800
        800                                                 700
        700
                                                           600
        600
                                                           500
        500
                                                           400
        400
                                                           300
       300

                                                           200
       200



                                                           100
       100




Figure5 : The PCR product NS2B(H) Den amplified      Figure 6 : The PCR product NS3protease Den amplified
from pTrc NS2B-NS3 Den (Lane 2 and 3). The size of   from pTrc NS2B-NS3 Den (Lane 3 and 4 ). The size of
NS2B(H) was 187 bp.                                  NS3 protease was 594 bp.
NS2B(H)-NS3p

                                                                                                                                                     NS2B(H)-NS3p
                    NS2B(H)-NS3p

                                   NS2B(H)-NS3p

                                                  NS2B(H)-NS3p

                                                                 NS2B(H)-NS3p

                                                                                NS2B(H)-NS3p




                                                                                                                          - Control
        - Control



                                                                                                              1500


                                                                                                               1000
                                                                                                               900
                                                                                               1500            800
                                                                                                               700
                                                                                               1000            600
                                                                                                900            500
                                                                                                800
                                                                                                700            400
                                                                                               600
                                                                                               500             300
                                                                                               400
                                                                                                               200
                                                                                               300


                                                                                               200




Figure 7 : The SOE-PCR product NS2B(H)-NS3protease                                                    Figure 8 :The NS2B(H)-NS3protease Den (Lane 3 and
Den (Lane 2 and 6). The size of NS2B(H)-NS3 protease                                                  4 ) after digested with BamHI and KpnI. The size of
was 765 bp.                                                                                           NS2B(H)-NS3 protease was 765 bp.
Method & Result
                       pTrcHis A


    Digest with BamHI      Digest with KpnI


    Digest with KpnI        Digest with BamHI


Gel Electrophoresis & Clean with Gel Extraction Kits
with BamHI
                                                                                    Digested pTrcHis A
                                                                                                         with KpnI
                                                                                                         Digested pTrcHis A
                                                                        pTrcHis A
       23.13 kb
       9.42 kb                                         23.13 kb
       6.56 kb
                                                        9.42 kb
       4.56 kb                                          6.56 kb
                                                        4.56 kb
        2.32 kb
        2.03 kb
                                                       2.32 kb
                                                       2.03 kb




Figure 9 : The pTrcHis A in lane 2 without digestion   Figure 10 : The pTrcHis A in lane digested with
                                                       BamHI and KpnI in lane 3 and 4.In line 1 is
                                                       pTrcHis A without digestion.
Method & Result
NS2B(H)-NS3p JEV
                             pTrcHis A
NS2B(H)-NS3p Den


         Ligation & Transformation


 Site Screening & Digest with Restriction Enzyme
Dengue Clone 1-5




                                                                    Dengue Clone 11-15

                                                                                         Dengue Clone 16-20

                                                                                                              Dengue Clone 21-25
                                                Dengue Clone 6-10




                                                                                                                                                                                                                                   Dengue Clone 4

                                                                                                                                                                                                                                                    Dengue Clone 5

                                                                                                                                                                                                                                                                     Dengue Clone 6



                                                                                                                                                                                                                                                                                                       Dengue Clone 8

                                                                                                                                                                                                                                                                                                                        Dengue Clone 9
                                                                                                                                                                                Dengue Clone 1

                                                                                                                                                                                                 Dengue Clone 2

                                                                                                                                                                                                                  Dengue Clone 3




                                                                                                                                                                                                                                                                                      Dengue Clone 7
                                                                                                                                                                 NS2B(H)-NS3p
                                                                                                                                   JEV Clone 1




                                                                                                                                                                                                                                                                                                                                         JEV Clone 1
                 pTrcHis A
                                                                                                                                                 23.13 kb
23.13 kb
                                                                                                                                                  9.42 kb
9.42 kb                                                                                                                                           6.56 kb
6.56 kb
                                                                                                                                                  4.56 kb
4.56 kb
2.32 kb                                                                                                                                           2.32 kb
2.03 kb                                                                                                                                           2.03 kb



                                                                                                                                                 700 bp




                                                                                                                                                            Figure 12 : The pTrcHis NS2B(H)-NS3protease JEV
 Figure 11 : The pTrcHis NS2B(H)-NS3protease JEV
                                                                                                                                                            (lane 12) and pTrcHis NS2B(H)-NS3protease Den
 (lane 8) and pTrcHis NS2B(H)-NS3protease Den (lane
                                                                                                                                                            clone 1-9 (lane 3 to 11) was digested with BamHI and
 3 to 7) was digested with BamHI.
                                                                                                                                                            KpnI.
Conclusion
• The NS2B(H)-NS3p JEV and NS2B(H)-NS3p
  Den was successfully PCR and ligated into
  pTrcHis A plasmid.
• The digestion of the recombinant vector
  shown the expect band of pTrcHis with the
  insert, then it need to purify and sequence
  the plasmid to make sure,that is the correct
  plasmid.
Future Work
• Check another clone to get more positive
  clone.
• Construct NS2B(H)Den-NS3p JE and
  NS2B(H) JE-NS3p Den.
• Retransform into E.coli C41.
• Purification of Protein.
• Enzyme assay.
Thank you for your
    attention.

Más contenido relacionado

Más de Chakard Chalayut

Data and personality introducing psychologic
Data and personality introducing psychologic Data and personality introducing psychologic
Data and personality introducing psychologic Chakard Chalayut
 
The power of user psychology and behaviour
The power of user psychology and behaviourThe power of user psychology and behaviour
The power of user psychology and behaviourChakard Chalayut
 
Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Chakard Chalayut
 
Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Chakard Chalayut
 
Marketing Trend from Global
Marketing Trend from Global Marketing Trend from Global
Marketing Trend from Global Chakard Chalayut
 
about SXSW 2018 in AI topic
about SXSW 2018 in AI topicabout SXSW 2018 in AI topic
about SXSW 2018 in AI topicChakard Chalayut
 
Total Experience Journey Management
Total Experience Journey Management Total Experience Journey Management
Total Experience Journey Management Chakard Chalayut
 
Can we predict human future with data
Can we predict human future with dataCan we predict human future with data
Can we predict human future with dataChakard Chalayut
 
End of content era, Long live the Human Experience
End of content era, Long live the Human Experience End of content era, Long live the Human Experience
End of content era, Long live the Human Experience Chakard Chalayut
 
What da heck is Digital marketing?
What da heck is Digital marketing?What da heck is Digital marketing?
What da heck is Digital marketing?Chakard Chalayut
 
Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Chakard Chalayut
 
Social Media for non profit
Social Media for non profitSocial Media for non profit
Social Media for non profitChakard Chalayut
 
How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2Chakard Chalayut
 
How to participate in Barcamp
How to participate in BarcampHow to participate in Barcamp
How to participate in BarcampChakard Chalayut
 

Más de Chakard Chalayut (20)

Data and personality introducing psychologic
Data and personality introducing psychologic Data and personality introducing psychologic
Data and personality introducing psychologic
 
The power of user psychology and behaviour
The power of user psychology and behaviourThe power of user psychology and behaviour
The power of user psychology and behaviour
 
Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability
 
Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing
 
Marketing Trend from Global
Marketing Trend from Global Marketing Trend from Global
Marketing Trend from Global
 
Digital media 2018
Digital media 2018Digital media 2018
Digital media 2018
 
about SXSW 2018 in AI topic
about SXSW 2018 in AI topicabout SXSW 2018 in AI topic
about SXSW 2018 in AI topic
 
World of chaos
World of chaosWorld of chaos
World of chaos
 
Total Experience Journey Management
Total Experience Journey Management Total Experience Journey Management
Total Experience Journey Management
 
Can we predict human future with data
Can we predict human future with dataCan we predict human future with data
Can we predict human future with data
 
End of content era, Long live the Human Experience
End of content era, Long live the Human Experience End of content era, Long live the Human Experience
End of content era, Long live the Human Experience
 
What da heck is Digital marketing?
What da heck is Digital marketing?What da heck is Digital marketing?
What da heck is Digital marketing?
 
Scratch 2 Social Media
Scratch 2 Social Media Scratch 2 Social Media
Scratch 2 Social Media
 
Scratch to Social Media
Scratch to Social Media Scratch to Social Media
Scratch to Social Media
 
Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry
 
Social Media for non profit
Social Media for non profitSocial Media for non profit
Social Media for non profit
 
Social media CRM
Social media CRMSocial media CRM
Social media CRM
 
Thinkcamp
ThinkcampThinkcamp
Thinkcamp
 
How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2
 
How to participate in Barcamp
How to participate in BarcampHow to participate in Barcamp
How to participate in Barcamp
 

Último

03_Emmanuel Ndiaye_Degroof Petercam.pptx
03_Emmanuel Ndiaye_Degroof Petercam.pptx03_Emmanuel Ndiaye_Degroof Petercam.pptx
03_Emmanuel Ndiaye_Degroof Petercam.pptxFinTech Belgium
 
VIP Kolkata Call Girl Serampore 👉 8250192130 Available With Room
VIP Kolkata Call Girl Serampore 👉 8250192130  Available With RoomVIP Kolkata Call Girl Serampore 👉 8250192130  Available With Room
VIP Kolkata Call Girl Serampore 👉 8250192130 Available With Roomdivyansh0kumar0
 
(DIYA) Bhumkar Chowk Call Girls Just Call 7001035870 [ Cash on Delivery ] Pun...
(DIYA) Bhumkar Chowk Call Girls Just Call 7001035870 [ Cash on Delivery ] Pun...(DIYA) Bhumkar Chowk Call Girls Just Call 7001035870 [ Cash on Delivery ] Pun...
(DIYA) Bhumkar Chowk Call Girls Just Call 7001035870 [ Cash on Delivery ] Pun...ranjana rawat
 
Instant Issue Debit Cards - School Designs
Instant Issue Debit Cards - School DesignsInstant Issue Debit Cards - School Designs
Instant Issue Debit Cards - School Designsegoetzinger
 
VVIP Pune Call Girls Katraj (7001035870) Pune Escorts Nearby with Complete Sa...
VVIP Pune Call Girls Katraj (7001035870) Pune Escorts Nearby with Complete Sa...VVIP Pune Call Girls Katraj (7001035870) Pune Escorts Nearby with Complete Sa...
VVIP Pune Call Girls Katraj (7001035870) Pune Escorts Nearby with Complete Sa...Call Girls in Nagpur High Profile
 
The Economic History of the U.S. Lecture 20.pdf
The Economic History of the U.S. Lecture 20.pdfThe Economic History of the U.S. Lecture 20.pdf
The Economic History of the U.S. Lecture 20.pdfGale Pooley
 
Russian Call Girls In Gtb Nagar (Delhi) 9711199012 💋✔💕😘 Naughty Call Girls Se...
Russian Call Girls In Gtb Nagar (Delhi) 9711199012 💋✔💕😘 Naughty Call Girls Se...Russian Call Girls In Gtb Nagar (Delhi) 9711199012 💋✔💕😘 Naughty Call Girls Se...
Russian Call Girls In Gtb Nagar (Delhi) 9711199012 💋✔💕😘 Naughty Call Girls Se...shivangimorya083
 
Call Girls Koregaon Park Call Me 7737669865 Budget Friendly No Advance Booking
Call Girls Koregaon Park Call Me 7737669865 Budget Friendly No Advance BookingCall Girls Koregaon Park Call Me 7737669865 Budget Friendly No Advance Booking
Call Girls Koregaon Park Call Me 7737669865 Budget Friendly No Advance Bookingroncy bisnoi
 
Log your LOA pain with Pension Lab's brilliant campaign
Log your LOA pain with Pension Lab's brilliant campaignLog your LOA pain with Pension Lab's brilliant campaign
Log your LOA pain with Pension Lab's brilliant campaignHenry Tapper
 
Call Girls Service Nagpur Maya Call 7001035870 Meet With Nagpur Escorts
Call Girls Service Nagpur Maya Call 7001035870 Meet With Nagpur EscortsCall Girls Service Nagpur Maya Call 7001035870 Meet With Nagpur Escorts
Call Girls Service Nagpur Maya Call 7001035870 Meet With Nagpur Escortsranjana rawat
 
Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...
Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...
Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...ssifa0344
 
High Class Call Girls Nashik Maya 7001305949 Independent Escort Service Nashik
High Class Call Girls Nashik Maya 7001305949 Independent Escort Service NashikHigh Class Call Girls Nashik Maya 7001305949 Independent Escort Service Nashik
High Class Call Girls Nashik Maya 7001305949 Independent Escort Service NashikCall Girls in Nagpur High Profile
 
05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx
05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx
05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptxFinTech Belgium
 
20240417-Calibre-April-2024-Investor-Presentation.pdf
20240417-Calibre-April-2024-Investor-Presentation.pdf20240417-Calibre-April-2024-Investor-Presentation.pdf
20240417-Calibre-April-2024-Investor-Presentation.pdfAdnet Communications
 
TEST BANK For Corporate Finance, 13th Edition By Stephen Ross, Randolph Weste...
TEST BANK For Corporate Finance, 13th Edition By Stephen Ross, Randolph Weste...TEST BANK For Corporate Finance, 13th Edition By Stephen Ross, Randolph Weste...
TEST BANK For Corporate Finance, 13th Edition By Stephen Ross, Randolph Weste...ssifa0344
 
Q3 2024 Earnings Conference Call and Webcast Slides
Q3 2024 Earnings Conference Call and Webcast SlidesQ3 2024 Earnings Conference Call and Webcast Slides
Q3 2024 Earnings Conference Call and Webcast SlidesMarketing847413
 
Independent Call Girl Number in Kurla Mumbai📲 Pooja Nehwal 9892124323 💞 Full ...
Independent Call Girl Number in Kurla Mumbai📲 Pooja Nehwal 9892124323 💞 Full ...Independent Call Girl Number in Kurla Mumbai📲 Pooja Nehwal 9892124323 💞 Full ...
Independent Call Girl Number in Kurla Mumbai📲 Pooja Nehwal 9892124323 💞 Full ...Pooja Nehwal
 
The Economic History of the U.S. Lecture 18.pdf
The Economic History of the U.S. Lecture 18.pdfThe Economic History of the U.S. Lecture 18.pdf
The Economic History of the U.S. Lecture 18.pdfGale Pooley
 
The Economic History of the U.S. Lecture 30.pdf
The Economic History of the U.S. Lecture 30.pdfThe Economic History of the U.S. Lecture 30.pdf
The Economic History of the U.S. Lecture 30.pdfGale Pooley
 
02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx
02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx
02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptxFinTech Belgium
 

Último (20)

03_Emmanuel Ndiaye_Degroof Petercam.pptx
03_Emmanuel Ndiaye_Degroof Petercam.pptx03_Emmanuel Ndiaye_Degroof Petercam.pptx
03_Emmanuel Ndiaye_Degroof Petercam.pptx
 
VIP Kolkata Call Girl Serampore 👉 8250192130 Available With Room
VIP Kolkata Call Girl Serampore 👉 8250192130  Available With RoomVIP Kolkata Call Girl Serampore 👉 8250192130  Available With Room
VIP Kolkata Call Girl Serampore 👉 8250192130 Available With Room
 
(DIYA) Bhumkar Chowk Call Girls Just Call 7001035870 [ Cash on Delivery ] Pun...
(DIYA) Bhumkar Chowk Call Girls Just Call 7001035870 [ Cash on Delivery ] Pun...(DIYA) Bhumkar Chowk Call Girls Just Call 7001035870 [ Cash on Delivery ] Pun...
(DIYA) Bhumkar Chowk Call Girls Just Call 7001035870 [ Cash on Delivery ] Pun...
 
Instant Issue Debit Cards - School Designs
Instant Issue Debit Cards - School DesignsInstant Issue Debit Cards - School Designs
Instant Issue Debit Cards - School Designs
 
VVIP Pune Call Girls Katraj (7001035870) Pune Escorts Nearby with Complete Sa...
VVIP Pune Call Girls Katraj (7001035870) Pune Escorts Nearby with Complete Sa...VVIP Pune Call Girls Katraj (7001035870) Pune Escorts Nearby with Complete Sa...
VVIP Pune Call Girls Katraj (7001035870) Pune Escorts Nearby with Complete Sa...
 
The Economic History of the U.S. Lecture 20.pdf
The Economic History of the U.S. Lecture 20.pdfThe Economic History of the U.S. Lecture 20.pdf
The Economic History of the U.S. Lecture 20.pdf
 
Russian Call Girls In Gtb Nagar (Delhi) 9711199012 💋✔💕😘 Naughty Call Girls Se...
Russian Call Girls In Gtb Nagar (Delhi) 9711199012 💋✔💕😘 Naughty Call Girls Se...Russian Call Girls In Gtb Nagar (Delhi) 9711199012 💋✔💕😘 Naughty Call Girls Se...
Russian Call Girls In Gtb Nagar (Delhi) 9711199012 💋✔💕😘 Naughty Call Girls Se...
 
Call Girls Koregaon Park Call Me 7737669865 Budget Friendly No Advance Booking
Call Girls Koregaon Park Call Me 7737669865 Budget Friendly No Advance BookingCall Girls Koregaon Park Call Me 7737669865 Budget Friendly No Advance Booking
Call Girls Koregaon Park Call Me 7737669865 Budget Friendly No Advance Booking
 
Log your LOA pain with Pension Lab's brilliant campaign
Log your LOA pain with Pension Lab's brilliant campaignLog your LOA pain with Pension Lab's brilliant campaign
Log your LOA pain with Pension Lab's brilliant campaign
 
Call Girls Service Nagpur Maya Call 7001035870 Meet With Nagpur Escorts
Call Girls Service Nagpur Maya Call 7001035870 Meet With Nagpur EscortsCall Girls Service Nagpur Maya Call 7001035870 Meet With Nagpur Escorts
Call Girls Service Nagpur Maya Call 7001035870 Meet With Nagpur Escorts
 
Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...
Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...
Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...
 
High Class Call Girls Nashik Maya 7001305949 Independent Escort Service Nashik
High Class Call Girls Nashik Maya 7001305949 Independent Escort Service NashikHigh Class Call Girls Nashik Maya 7001305949 Independent Escort Service Nashik
High Class Call Girls Nashik Maya 7001305949 Independent Escort Service Nashik
 
05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx
05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx
05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx
 
20240417-Calibre-April-2024-Investor-Presentation.pdf
20240417-Calibre-April-2024-Investor-Presentation.pdf20240417-Calibre-April-2024-Investor-Presentation.pdf
20240417-Calibre-April-2024-Investor-Presentation.pdf
 
TEST BANK For Corporate Finance, 13th Edition By Stephen Ross, Randolph Weste...
TEST BANK For Corporate Finance, 13th Edition By Stephen Ross, Randolph Weste...TEST BANK For Corporate Finance, 13th Edition By Stephen Ross, Randolph Weste...
TEST BANK For Corporate Finance, 13th Edition By Stephen Ross, Randolph Weste...
 
Q3 2024 Earnings Conference Call and Webcast Slides
Q3 2024 Earnings Conference Call and Webcast SlidesQ3 2024 Earnings Conference Call and Webcast Slides
Q3 2024 Earnings Conference Call and Webcast Slides
 
Independent Call Girl Number in Kurla Mumbai📲 Pooja Nehwal 9892124323 💞 Full ...
Independent Call Girl Number in Kurla Mumbai📲 Pooja Nehwal 9892124323 💞 Full ...Independent Call Girl Number in Kurla Mumbai📲 Pooja Nehwal 9892124323 💞 Full ...
Independent Call Girl Number in Kurla Mumbai📲 Pooja Nehwal 9892124323 💞 Full ...
 
The Economic History of the U.S. Lecture 18.pdf
The Economic History of the U.S. Lecture 18.pdfThe Economic History of the U.S. Lecture 18.pdf
The Economic History of the U.S. Lecture 18.pdf
 
The Economic History of the U.S. Lecture 30.pdf
The Economic History of the U.S. Lecture 30.pdfThe Economic History of the U.S. Lecture 30.pdf
The Economic History of the U.S. Lecture 30.pdf
 
02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx
02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx
02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx
 

Evaluation I.Key

  • 1. Cloning, Expression, Purification and Enzymological Characterization of NS2B/NS3 Protease / RNA Helicase protein of Japanese Encephalitis Virus. Chakard Chalayut Advisor: Asst. Prof. Gerd Katzenmeier, Ph.D. Laboratory of Molecular Virology Institute of Molecular Biology & Genetics
  • 2. Japanese Encephalitis Virus -Flaviviridae family -Mosquito-borne neurotropic flavivirus •causes severe central nerve system diseases
  • 3. Japanese Encephalitis Virus Culex tritaeniorhynchus. Source : vietnammedicalpractice.com Source: fehd.gov.hk
  • 4. Japanese Encephalitis Virus JEV causes severe central nerve system diseases such as 50,000 Cases 10,000 p o l i o mye l i t i s - l i ke 30% fatality rate acute flaccid paralysis, aseptic meningitis and encephalitis Source:wonder.cdc.gov Source: cdc.gov
  • 5. Prevention and treatment of JEV disease Drug No drug exist Vaccine development Available vaccine Elimination of mosquitoes Mosquitoes control breeding places
  • 6. Molecular biology of Japanese Encephalitis Virus Source : molecular-virology.uni-hd.de
  • 7. The NS2B • 130 aa Hypothetical model • activating domain NS2B-NS3 complex central hydrophilic region (Falgout et al, 1993) • 3 membrane spanning parts hydrophobicity plot ฺBrinkworth et al, 1999 51 DMWLERAADISWEMDAAITGSSRRLDVKLDDDGDFHLIDDPGVP 95
  • 8. The NS3 Protease NTPase •Chymotrypsin-like fold 2-β barrel Helicase RNA domains •Inactive alone Theoretical model from PDB •Enzyme’s pocket is small 2I84
  • 9. The NS3 protease Complexation with NS2B cofactor • conformational change serine protease NS3 alteration of the enzyme pocket additional substrate binding 20 kDa domain site •catalytic residues His51, Asp75, Ser135
  • 10. Background • NS2B(H) JE - NS3p Den did not cleaved Den polyprotein but NS2B(H) Den - NS3p JE cleaved JEV polyprotein. • The C-terminal portion of Den NS2B is required for interaction with Den NS3 to activate protease. • Jan. L R et al, 1995
  • 11. Background • Ser to Ile60 were essential region required for NS3 46 protease activity. • Ala substition of Trp 50, Glu55, and Arg56 in NS2B shown significantly reduced NS3 protease activity. • Lin. C W et al,2007
  • 12. Objective • to perform cloning of the NS2B-NS3 portion of the JEV polyprotein, express in E.coli and biochemically purify to determinants of clevage activity and cofactor requirement will be analyzed and compared to dengue virus. • The second objective is to study differences in substrate specificity and inhibitors by using peptide substrates incorporated with fluorogenic or chromogenic reported groups.
  • 13. Method & Result pLS with NS2B-NS3 JEV NS2B(H) NS3p SOE-PCR NS2B(H)-NS3p
  • 14. NS2B(H) NS2B NS3p NS3 NS2B(H) NS3p
  • 15. - Control NS2B(H) NS2B(H) NS3 protease NS3 protease NS3 protease - Control 1500 1500 1000 900 800 1000 700 900 800 600 700 500 600 400 500 400 300 300 200 200 Figure 1 : The PCR product NS2B(H) JEV amplified Figure 2 : The PCR product NS3protease JEV from NS2B-NS3 JEV (Lane 3 and 4). The size of amplified from NS2B-NS3 JEV (Lane 3 to 5 ). The size NS2B(H) was 187 bp. of NS3 protease was 594 bp.
  • 16. NS2B(H)-NS3p - Control NS2B(H)-NS3p - Control 1500 1000 900 1500 800 700 600 1000 900 500 800 400 700 600 300 500 400 200 300 100 Figure 3 : The SOE-PCR product NS2B(H)- Figure 4 : The NS2B(H)-NS3protease JEV NS3protease JEV (Lane 2 to 5 ). The size of (Lane 3 ) after digested with BamHI and KpnI. NS2B(H)-NS3 protease was 765 bp. The size of NS2B(H)-NS3 protease was 765 bp.
  • 17. Method & Result pTrcHis Den with NS2B-NS3 Den NS2B(H) NS3p SOE-PCR NS2B(H)-NS3p Den
  • 18. NS3 protease NS3 protease - Control - Control NS2B(H) NS2B(H) 1500 1500 1000 1000 900 900 800 800 700 700 600 600 500 500 400 400 300 300 200 200 100 100 Figure5 : The PCR product NS2B(H) Den amplified Figure 6 : The PCR product NS3protease Den amplified from pTrc NS2B-NS3 Den (Lane 2 and 3). The size of from pTrc NS2B-NS3 Den (Lane 3 and 4 ). The size of NS2B(H) was 187 bp. NS3 protease was 594 bp.
  • 19. NS2B(H)-NS3p NS2B(H)-NS3p NS2B(H)-NS3p NS2B(H)-NS3p NS2B(H)-NS3p NS2B(H)-NS3p NS2B(H)-NS3p - Control - Control 1500 1000 900 1500 800 700 1000 600 900 500 800 700 400 600 500 300 400 200 300 200 Figure 7 : The SOE-PCR product NS2B(H)-NS3protease Figure 8 :The NS2B(H)-NS3protease Den (Lane 3 and Den (Lane 2 and 6). The size of NS2B(H)-NS3 protease 4 ) after digested with BamHI and KpnI. The size of was 765 bp. NS2B(H)-NS3 protease was 765 bp.
  • 20. Method & Result pTrcHis A Digest with BamHI Digest with KpnI Digest with KpnI Digest with BamHI Gel Electrophoresis & Clean with Gel Extraction Kits
  • 21. with BamHI Digested pTrcHis A with KpnI Digested pTrcHis A pTrcHis A 23.13 kb 9.42 kb 23.13 kb 6.56 kb 9.42 kb 4.56 kb 6.56 kb 4.56 kb 2.32 kb 2.03 kb 2.32 kb 2.03 kb Figure 9 : The pTrcHis A in lane 2 without digestion Figure 10 : The pTrcHis A in lane digested with BamHI and KpnI in lane 3 and 4.In line 1 is pTrcHis A without digestion.
  • 22. Method & Result NS2B(H)-NS3p JEV pTrcHis A NS2B(H)-NS3p Den Ligation & Transformation Site Screening & Digest with Restriction Enzyme
  • 23. Dengue Clone 1-5 Dengue Clone 11-15 Dengue Clone 16-20 Dengue Clone 21-25 Dengue Clone 6-10 Dengue Clone 4 Dengue Clone 5 Dengue Clone 6 Dengue Clone 8 Dengue Clone 9 Dengue Clone 1 Dengue Clone 2 Dengue Clone 3 Dengue Clone 7 NS2B(H)-NS3p JEV Clone 1 JEV Clone 1 pTrcHis A 23.13 kb 23.13 kb 9.42 kb 9.42 kb 6.56 kb 6.56 kb 4.56 kb 4.56 kb 2.32 kb 2.32 kb 2.03 kb 2.03 kb 700 bp Figure 12 : The pTrcHis NS2B(H)-NS3protease JEV Figure 11 : The pTrcHis NS2B(H)-NS3protease JEV (lane 12) and pTrcHis NS2B(H)-NS3protease Den (lane 8) and pTrcHis NS2B(H)-NS3protease Den (lane clone 1-9 (lane 3 to 11) was digested with BamHI and 3 to 7) was digested with BamHI. KpnI.
  • 24. Conclusion • The NS2B(H)-NS3p JEV and NS2B(H)-NS3p Den was successfully PCR and ligated into pTrcHis A plasmid. • The digestion of the recombinant vector shown the expect band of pTrcHis with the insert, then it need to purify and sequence the plasmid to make sure,that is the correct plasmid.
  • 25. Future Work • Check another clone to get more positive clone. • Construct NS2B(H)Den-NS3p JE and NS2B(H) JE-NS3p Den. • Retransform into E.coli C41. • Purification of Protein. • Enzyme assay.
  • 26. Thank you for your attention.