SlideShare una empresa de Scribd logo
1 de 22
Descargar para leer sin conexión
©2015 Waters Corporation 1
Identification of Meat Species in
Processed Foods using
Mass Spectrometry
©2015 Waters Corporation 2
Presentation Overview
 Background
– Food labelling regulations
– Water retaining agents in chicken products
– Use of gelatine
 Research Objectives
 Proposed solution
– Sample preparation procedure
– LC-MS approach
– Data interpretation
 Results
– Identification of potential peptide markers
– Quantification of markers
 Future work using Xevo TQ-S
 Conclusions
©2015 Waters Corporation 3
Meat speciation – regulatory
requirements
 Authenticity of food and the accuracy of package labeling is important
to both consumers and food producers
 Within the EC food labeling regulations exist
– ~5 M people in UK have preferences concerning consumption of certain
species
 Composition of injection powders?
– Undeclared water-retaining hydrolysed proteins from pork and beef
used in chicken products
– Some chicken products potentially unsuitable for consumers
 Need to verify the species of gelatine used in food
©2015 Waters Corporation 4
Injection powders - gelatine
 What is it?
– Bi-product from the meat / fish industry
– partial hydrolysis of collagen extracted from skin,
bones, connective tissue
 Properties of gelatine
– Gelling agent
– Semi-solid colloid gel
– Texture enhancer
 Approx annual production:
– Europe: 117kt (70% used in food)
 What is it used for?
– Food and Beverages
– Drugs and capsules
– Cosmetics
– Photographic film
– Fertilisers…
©2015 Waters Corporation 5
Research objectives and aims
 Develop a method to detect species and tissue origin of meat
ingredients present in meat products
1. To identify unequivocal markers that can indicate the presence of
bovine or porcine gelatine
2. To determine whether chicken products have been adulterated
with proteins from other animal species
3. To develop a robust and transferable method
 Current limitations…
– Paper trail is not sufficient
– FSA concluded that PCR / IA based strategies are not reliable
• DNA markers damaged by processing conditions
• False negative rate
 Possible Solutions?
– LC-MS/MS using a proteomic workflow
©2015 Waters Corporation 6
Alternative strategy =
proteomic based analytical strategy to
identify peptide markers using HR-MS
©2015 Waters Corporation 7
Bottom-up proteomic experiment
1. Enzyme
digestion
2. UPLC
separation
Precursor
ions
MSE product
ions
3. MS
analysis
4. Data
interpretation
©2015 Waters Corporation 8
Meat Speciation Workflow
SAMPLE PREPARATION
(1) Tryptic digest (2) ADH addition
DATA ACQUISITION
Acquire data-independent MSE Data
SOFTWARE PROCESSING
IdentityE and gelatine database (BioArch)
ANALYTICAL SYSTEMS
(1) nanoACQUITY UPLC ® (2) XevoTM QTof MS
Nano-scale
separations
•Resolution
•Peak shape
•Number of
components
/ analytical
run
Full scan,
accurate
mass
©2015 Waters Corporation 9
Meat Speciation Workflow
Sample Preparation
 Samples
– Protein tryptic digests;
o pork gelatine
o beef gelatine
o pork & beef gelatine mix
 Tryptic digest
– 250 μg of porcine and bovine gelatine were hydrolysed with 5 μg of
sequence grade trypsin for 16hr
 ADH addition
– Quench reaction with formic acid
– 10 fmol of yeast alcohol dehydrogenase (internal standard) added
tryptic digest
SAMPLE PREPARATION
(1) Tryptic digest (2) ADH addition
©2015 Waters Corporation 10
UPLC Conditions
 System
– NanoACQUITY® UPLC
 Column:
– 75 µm x 15 cm BEH C18 column
 Gradient:
– 1 to 40% acetonitrile
– 90 min
 Flow rate:
– 300 nL/min
 Triplicate analysis
MS Conditions
 System
– Xevo QTof MS
 Mass range:
– m/z 50-1990
 Data Acquisition:
– MSE
 Collision energy:
– Low energy - 4 eV
– High energy - 12-35 eV
 Acquisition scan time:
– 0.9 s/function
Meat Speciation Workflow
UPLC-MS conditions
OPTIMISED ANALYTICAL PARAMETERS
(1) nanoACQUITY UPLC ® (2) XevoTM QTof MS
©2015 Waters Corporation 11
Meat Speciation Workflow
MSE
 UPLC-MSE is a data independent parallel process that occurs in
the collision cell
 The instrument is operated in an alternative scanning mode
providing two MS scan functions for data acquisition in one
analytical run
– Function 1 = low collision energy (precursor ions) Function 2 =
high energy (fragment ions)
DATA ACQUISITION
Acquire data-independent MSE Data
©2015 Waters Corporation 12
Meat Speciation Workflow
Software processing
SOFTWARE PROCESSING
PLGS and IdentityE
Positive matches referenced to
database library
Increasing confidence in assignment of peptides
©2015 Waters Corporation 13
Results and Discussion
©2015 Waters Corporation 14
nanoACQUITY replicate injections (n=3)
Beef gelatine
Repeatable results
Overlay low energy MSE chromatograms
©2015 Waters Corporation 15
Meat Speciation Workflow
Software processing
High energy product ion data gives increased confidence in peptide sequence identification
Low energy data can be displayed as a mass
spectrum or a chromatogram
Markers originated from a SINGLE protein
Unique marker peptides sequences listed here
©2015 Waters Corporation 16
Discovery & Identification
Total Marker Peptides
Aim to obtain a peptide marker that is unmodified (if possible)
 Over 60 collagen peptides were identified in samples of both bovine and
porcine gelatines
 IdentityE did not identify peptides from any other proteins
– Collagen
– Yeast ADH
 Indicates the samples were 100% gelatine
Multiple
forms of the
peptides
identified
Species peptide Peptide mass Type of peptide modification
Bovine
GYPGNPGPAGAAGAP 1235.58 Non-tryptic cleavage product
GYPGNPGPAGAAGAPGPQGAVGPAGK 2173.08 Unmodified peptide
GYPGNPGPAGAAGAPGPQGAVGPAGK 2189.07 Hydroxyl of single proline
GYPGNPGPAGAAGAPGPQGAVGPAGK 2205.07 Hydroxylation of prolines 3 and 15
GYPGNPGPAGAAGAPGPQGAVGPAGK 2221.06 Three hydroxyprolines
GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2653.3 Missed tryptic cleavage hydroxylation of proline
29
GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2669.29 Missed cleavage plus two proline hydroxylations
Porcine
IGQPGAVGPAGIR 1192.68 Deamidation + Q3
IGQPGAVGPAGIR 1193.66 Hydroxyl + DKNP 4
IGQPGAVGPAGIR 1208.67
IGQPGAVGPAGIR 1209.66 Deamidation +Q3; Hydroxyl+DKNP9
©2015 Waters Corporation 17
Discovery & Identification
Unique Unmodified Marker Peptides
Bovine peptide marker
IGQPGAVAPAGIR
Porcine peptide marker
TGQPGAVAPAGIR
Comparison of high energy MSE fragment ion spectra
Differences
in b and y
ions formed
©2015 Waters Corporation 18
Quantification
Porcine and bovine gelatine
 Use of ADH enabled quantification of proteins in sample
Removes need to use labelling systems for peptide and
protein quantification
Test mix was prepared
Addition of 15%(w/w) bovine gelatine in porcine gelatine
Results
Three bovine and porcine peptides were selected - relative
bovine gelatine content of ~ 16.8%
©2015 Waters Corporation 19
Conclusions
 Highly processed food proteins, such as gelatine, that
are devoid of DNA signature can be speciated using
LC-MS
 Protein sequence database analysis identified peptide
sequences within the protein that are species specific
 Waters Xevo Qtof MS was able to identify these
sequences, even after significant modification of the
amino acids
 The interrogation of the total protein complement of
the sample also provided potential information on
non-gelatine proteins in the samples
©2015 Waters Corporation 20
Further Work
Preliminary data suggests the method can
be used to quantify the species in mixtures
of gelatines
 Investigate the contribution that type III
collagen (from skin and connective tissue)
might make to the quantitative analysis
of gelatines
©2015 Waters Corporation 21
Future Work
Method transfer to routine analysis using tandem quad
MS/MS
©2015 Waters Corporation 22
Acknowledgments
Helen Grundy - Food and Environment
Research Agency, York, UK
BioArCh, University of York, UK
Thank you for your attention
Any Questions?

Más contenido relacionado

La actualidad más candente

Marker assissted selection
Marker assissted selectionMarker assissted selection
Marker assissted selectionmuzamil ahmad
 
Properties of food carbohydrates
Properties of food carbohydratesProperties of food carbohydrates
Properties of food carbohydratesRaaththikaR
 
Processing of Mayonnaise
Processing of Mayonnaise Processing of Mayonnaise
Processing of Mayonnaise Maira Jabeen
 
Determination of fat in milk
Determination of fat in milkDetermination of fat in milk
Determination of fat in milkamal shaukat
 
Application of raman spectroscopy in food analysis
Application of raman spectroscopy in food analysisApplication of raman spectroscopy in food analysis
Application of raman spectroscopy in food analysisKiran Qamar Kayani
 
Physical and chemical properties of milk
Physical and chemical properties of milkPhysical and chemical properties of milk
Physical and chemical properties of milkDhanya K C
 
traditional dairy products
traditional dairy productstraditional dairy products
traditional dairy productsRobinVarghese51
 
Sampling-procedures-of-milk-and-milk-products.pptx
Sampling-procedures-of-milk-and-milk-products.pptxSampling-procedures-of-milk-and-milk-products.pptx
Sampling-procedures-of-milk-and-milk-products.pptxManteeKumari
 
Types of food additives
Types of food additivesTypes of food additives
Types of food additivesJasmineJuliet
 
food additive regulations
food additive regulationsfood additive regulations
food additive regulationsjosnarajp
 
Categorization of risks and benefits (food additives)
Categorization of risks and benefits (food additives)Categorization of risks and benefits (food additives)
Categorization of risks and benefits (food additives)Domina Petric
 
Antioxidants, sweeteners and flavours
Antioxidants, sweeteners and flavoursAntioxidants, sweeteners and flavours
Antioxidants, sweeteners and flavoursSushant Gawali
 
cleaning and sanitation of milk plant.pptx
cleaning and sanitation of milk plant.pptxcleaning and sanitation of milk plant.pptx
cleaning and sanitation of milk plant.pptxSaranuTeja1
 
Food Analysis Quality Control
Food Analysis Quality ControlFood Analysis Quality Control
Food Analysis Quality ControlVedpal Yadav
 

La actualidad más candente (20)

paneer.pdf
paneer.pdfpaneer.pdf
paneer.pdf
 
Marker assissted selection
Marker assissted selectionMarker assissted selection
Marker assissted selection
 
Properties of food carbohydrates
Properties of food carbohydratesProperties of food carbohydrates
Properties of food carbohydrates
 
Processing of Mayonnaise
Processing of Mayonnaise Processing of Mayonnaise
Processing of Mayonnaise
 
Determination of fat in milk
Determination of fat in milkDetermination of fat in milk
Determination of fat in milk
 
Application of raman spectroscopy in food analysis
Application of raman spectroscopy in food analysisApplication of raman spectroscopy in food analysis
Application of raman spectroscopy in food analysis
 
EnviroMap
EnviroMap EnviroMap
EnviroMap
 
Nanotechnology in nutraceuticals and cosmetics
Nanotechnology in nutraceuticals and cosmeticsNanotechnology in nutraceuticals and cosmetics
Nanotechnology in nutraceuticals and cosmetics
 
Analysis of milk and milk product
Analysis of milk and milk productAnalysis of milk and milk product
Analysis of milk and milk product
 
Physical and chemical properties of milk
Physical and chemical properties of milkPhysical and chemical properties of milk
Physical and chemical properties of milk
 
traditional dairy products
traditional dairy productstraditional dairy products
traditional dairy products
 
Sampling-procedures-of-milk-and-milk-products.pptx
Sampling-procedures-of-milk-and-milk-products.pptxSampling-procedures-of-milk-and-milk-products.pptx
Sampling-procedures-of-milk-and-milk-products.pptx
 
Legislation Regulation of Food Products as per FDA
Legislation Regulation of Food Products as per FDALegislation Regulation of Food Products as per FDA
Legislation Regulation of Food Products as per FDA
 
Types of food additives
Types of food additivesTypes of food additives
Types of food additives
 
food additive regulations
food additive regulationsfood additive regulations
food additive regulations
 
Categorization of risks and benefits (food additives)
Categorization of risks and benefits (food additives)Categorization of risks and benefits (food additives)
Categorization of risks and benefits (food additives)
 
Antioxidants, sweeteners and flavours
Antioxidants, sweeteners and flavoursAntioxidants, sweeteners and flavours
Antioxidants, sweeteners and flavours
 
cleaning and sanitation of milk plant.pptx
cleaning and sanitation of milk plant.pptxcleaning and sanitation of milk plant.pptx
cleaning and sanitation of milk plant.pptx
 
Food Analysis Quality Control
Food Analysis Quality ControlFood Analysis Quality Control
Food Analysis Quality Control
 
Molecular markers
Molecular markersMolecular markers
Molecular markers
 

Destacado

MASS SPECTROMETRY IN THE FIELD OF FOOD INDUSTRY
MASS SPECTROMETRY IN THE FIELD OF FOOD INDUSTRYMASS SPECTROMETRY IN THE FIELD OF FOOD INDUSTRY
MASS SPECTROMETRY IN THE FIELD OF FOOD INDUSTRYErin Davis
 
mass spectrometry for pesticides residue analysis- L3
mass spectrometry for pesticides residue analysis- L3mass spectrometry for pesticides residue analysis- L3
mass spectrometry for pesticides residue analysis- L3sherif Taha
 
Fish Identification Course
Fish Identification Course Fish Identification Course
Fish Identification Course usfws
 
mass spectrometry for pesticides residue analysis- L2
mass spectrometry for pesticides residue analysis- L2mass spectrometry for pesticides residue analysis- L2
mass spectrometry for pesticides residue analysis- L2sherif Taha
 
Dating Fossils And Rocks
Dating Fossils And RocksDating Fossils And Rocks
Dating Fossils And Rockswhittumjd
 
mass spectrometry for pesticides residue analysis- L1
mass spectrometry for pesticides residue analysis- L1mass spectrometry for pesticides residue analysis- L1
mass spectrometry for pesticides residue analysis- L1sherif Taha
 
Mass Spectrometry Applications and spectral interpretation: Basics
Mass Spectrometry Applications and spectral interpretation: BasicsMass Spectrometry Applications and spectral interpretation: Basics
Mass Spectrometry Applications and spectral interpretation: BasicsShreekant Deshpande
 
Ensuring You're Not The Weak Link In Food Traceability
Ensuring You're Not The Weak Link In Food TraceabilityEnsuring You're Not The Weak Link In Food Traceability
Ensuring You're Not The Weak Link In Food TraceabilityAudioEducator
 

Destacado (20)

MASS SPECTROMETRY IN THE FIELD OF FOOD INDUSTRY
MASS SPECTROMETRY IN THE FIELD OF FOOD INDUSTRYMASS SPECTROMETRY IN THE FIELD OF FOOD INDUSTRY
MASS SPECTROMETRY IN THE FIELD OF FOOD INDUSTRY
 
Analytical Technologies for the Identification of Food Fraud and Authenticati...
Analytical Technologies for the Identification of Food Fraud and Authenticati...Analytical Technologies for the Identification of Food Fraud and Authenticati...
Analytical Technologies for the Identification of Food Fraud and Authenticati...
 
mass spectrometry for pesticides residue analysis- L3
mass spectrometry for pesticides residue analysis- L3mass spectrometry for pesticides residue analysis- L3
mass spectrometry for pesticides residue analysis- L3
 
Fish Identification Course
Fish Identification Course Fish Identification Course
Fish Identification Course
 
Rapid Detection of Pesticides in Fruit Juice without Sample Preparation - Wat...
Rapid Detection of Pesticides in Fruit Juice without Sample Preparation - Wat...Rapid Detection of Pesticides in Fruit Juice without Sample Preparation - Wat...
Rapid Detection of Pesticides in Fruit Juice without Sample Preparation - Wat...
 
Discovery and Analysis of Peanut Allergens using Proteomic approaches with Io...
Discovery and Analysis of Peanut Allergens using Proteomic approaches with Io...Discovery and Analysis of Peanut Allergens using Proteomic approaches with Io...
Discovery and Analysis of Peanut Allergens using Proteomic approaches with Io...
 
Analysis of Mycotoxins by UPLC and Tandem Quadrupole Mass Spectrometry - Wate...
Analysis of Mycotoxins by UPLC and Tandem Quadrupole Mass Spectrometry - Wate...Analysis of Mycotoxins by UPLC and Tandem Quadrupole Mass Spectrometry - Wate...
Analysis of Mycotoxins by UPLC and Tandem Quadrupole Mass Spectrometry - Wate...
 
mass spectrometry for pesticides residue analysis- L2
mass spectrometry for pesticides residue analysis- L2mass spectrometry for pesticides residue analysis- L2
mass spectrometry for pesticides residue analysis- L2
 
Overview of Food Allergen Detection using Mass Spectrometry - Waters Corporat...
Overview of Food Allergen Detection using Mass Spectrometry - Waters Corporat...Overview of Food Allergen Detection using Mass Spectrometry - Waters Corporat...
Overview of Food Allergen Detection using Mass Spectrometry - Waters Corporat...
 
Dating Fossils And Rocks
Dating Fossils And RocksDating Fossils And Rocks
Dating Fossils And Rocks
 
Mass spectrometer
Mass spectrometerMass spectrometer
Mass spectrometer
 
mass spectrometry for pesticides residue analysis- L1
mass spectrometry for pesticides residue analysis- L1mass spectrometry for pesticides residue analysis- L1
mass spectrometry for pesticides residue analysis- L1
 
Mass Spectrometry Applications and spectral interpretation: Basics
Mass Spectrometry Applications and spectral interpretation: BasicsMass Spectrometry Applications and spectral interpretation: Basics
Mass Spectrometry Applications and spectral interpretation: Basics
 
The use of High Resolution Mass Spectrometry and Statistical Analysis in the ...
The use of High Resolution Mass Spectrometry and Statistical Analysis in the ...The use of High Resolution Mass Spectrometry and Statistical Analysis in the ...
The use of High Resolution Mass Spectrometry and Statistical Analysis in the ...
 
Investigating Fruit Juice Authenticity using MS - Waters Corporation Food Res...
Investigating Fruit Juice Authenticity using MS - Waters Corporation Food Res...Investigating Fruit Juice Authenticity using MS - Waters Corporation Food Res...
Investigating Fruit Juice Authenticity using MS - Waters Corporation Food Res...
 
Rapid evaporative ionisation mass spectrometry (REIMS) for Food applications ...
Rapid evaporative ionisation mass spectrometry (REIMS) for Food applications ...Rapid evaporative ionisation mass spectrometry (REIMS) for Food applications ...
Rapid evaporative ionisation mass spectrometry (REIMS) for Food applications ...
 
Mass spectrometry
Mass spectrometryMass spectrometry
Mass spectrometry
 
Ensuring You're Not The Weak Link In Food Traceability
Ensuring You're Not The Weak Link In Food TraceabilityEnsuring You're Not The Weak Link In Food Traceability
Ensuring You're Not The Weak Link In Food Traceability
 
The Analysis of Allergens in Raw and Roasted Peanuts using Nanoscale UPLC & T...
The Analysis of Allergens in Raw and Roasted Peanuts using Nanoscale UPLC & T...The Analysis of Allergens in Raw and Roasted Peanuts using Nanoscale UPLC & T...
The Analysis of Allergens in Raw and Roasted Peanuts using Nanoscale UPLC & T...
 
materias
materiasmaterias
materias
 

Similar a Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research

Can LCMSMS be used in horse meat detection?
Can LCMSMS be used in horse meat detection?Can LCMSMS be used in horse meat detection?
Can LCMSMS be used in horse meat detection?SCIEX
 
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...SCIEX
 
Tools for improved Protein Mass Spec Sample preparation by Promega
Tools for improved Protein Mass Spec Sample preparation by PromegaTools for improved Protein Mass Spec Sample preparation by Promega
Tools for improved Protein Mass Spec Sample preparation by PromegaMourad FERHAT, PhD
 
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 System
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 SystemQuantitative Analysis of Transporter Protein using TripleTOF® 6600 System
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 SystemSCIEX
 
Hydrolysate Characterization Technical Presentation Webinar11 2009
Hydrolysate Characterization Technical Presentation Webinar11 2009Hydrolysate Characterization Technical Presentation Webinar11 2009
Hydrolysate Characterization Technical Presentation Webinar11 2009Mason Williams
 
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...Waters Corporation
 
Animal species specific quantification of gelatin with TrustGel
Animal species specific quantification of gelatin with TrustGelAnimal species specific quantification of gelatin with TrustGel
Animal species specific quantification of gelatin with TrustGelAnne Kleinnijenhuis
 
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR SystemsProtein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR SystemsThermo Fisher Scientific
 
In-silico Proteolysis of food
In-silico Proteolysis of foodIn-silico Proteolysis of food
In-silico Proteolysis of foodShamim Hossain
 
Protein Qualitative Analysis Services
Protein Qualitative Analysis ServicesProtein Qualitative Analysis Services
Protein Qualitative Analysis ServicesCreative Proteomics
 
Proteomics & Metabolomics
Proteomics & MetabolomicsProteomics & Metabolomics
Proteomics & Metabolomicsgumccomm
 
Recombinant protein expression and purification Lecture
Recombinant protein expression and purification LectureRecombinant protein expression and purification Lecture
Recombinant protein expression and purification Lecturetest
 
High throughput, data independent acquisition for qualitative and quantitativ...
High throughput, data independent acquisition for qualitative and quantitativ...High throughput, data independent acquisition for qualitative and quantitativ...
High throughput, data independent acquisition for qualitative and quantitativ...SCIEX
 
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)
Peptide Mass Fingerprinting  (PMF) and Isotope Coded Affinity Tags (ICAT)Peptide Mass Fingerprinting  (PMF) and Isotope Coded Affinity Tags (ICAT)
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)Suresh Antre
 

Similar a Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research (20)

Can LCMSMS be used in horse meat detection?
Can LCMSMS be used in horse meat detection?Can LCMSMS be used in horse meat detection?
Can LCMSMS be used in horse meat detection?
 
Analysis of Milk and Egg Allergens in Wine using UPLC-MS - Waters Corporation...
Analysis of Milk and Egg Allergens in Wine using UPLC-MS - Waters Corporation...Analysis of Milk and Egg Allergens in Wine using UPLC-MS - Waters Corporation...
Analysis of Milk and Egg Allergens in Wine using UPLC-MS - Waters Corporation...
 
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
 
Tools for improved Protein Mass Spec Sample preparation by Promega
Tools for improved Protein Mass Spec Sample preparation by PromegaTools for improved Protein Mass Spec Sample preparation by Promega
Tools for improved Protein Mass Spec Sample preparation by Promega
 
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 System
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 SystemQuantitative Analysis of Transporter Protein using TripleTOF® 6600 System
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 System
 
Hydrolysate Characterization Technical Presentation Webinar11 2009
Hydrolysate Characterization Technical Presentation Webinar11 2009Hydrolysate Characterization Technical Presentation Webinar11 2009
Hydrolysate Characterization Technical Presentation Webinar11 2009
 
Mtr corporate
Mtr corporateMtr corporate
Mtr corporate
 
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
 
Animal species specific quantification of gelatin with TrustGel
Animal species specific quantification of gelatin with TrustGelAnimal species specific quantification of gelatin with TrustGel
Animal species specific quantification of gelatin with TrustGel
 
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR SystemsProtein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
 
protea ILMAC 07 -cam
protea ILMAC 07 -camprotea ILMAC 07 -cam
protea ILMAC 07 -cam
 
In-silico Proteolysis of food
In-silico Proteolysis of foodIn-silico Proteolysis of food
In-silico Proteolysis of food
 
Protein Qualitative Analysis Services
Protein Qualitative Analysis ServicesProtein Qualitative Analysis Services
Protein Qualitative Analysis Services
 
Proteomics & Metabolomics
Proteomics & MetabolomicsProteomics & Metabolomics
Proteomics & Metabolomics
 
Recombinant protein expression and purification Lecture
Recombinant protein expression and purification LectureRecombinant protein expression and purification Lecture
Recombinant protein expression and purification Lecture
 
Bioactive peptides
Bioactive peptidesBioactive peptides
Bioactive peptides
 
Peptide mapping
Peptide mappingPeptide mapping
Peptide mapping
 
VTT's Emilia Nordlund: Bioprocessing as a tool to improve the functionality o...
VTT's Emilia Nordlund: Bioprocessing as a tool to improve the functionality o...VTT's Emilia Nordlund: Bioprocessing as a tool to improve the functionality o...
VTT's Emilia Nordlund: Bioprocessing as a tool to improve the functionality o...
 
High throughput, data independent acquisition for qualitative and quantitativ...
High throughput, data independent acquisition for qualitative and quantitativ...High throughput, data independent acquisition for qualitative and quantitativ...
High throughput, data independent acquisition for qualitative and quantitativ...
 
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)
Peptide Mass Fingerprinting  (PMF) and Isotope Coded Affinity Tags (ICAT)Peptide Mass Fingerprinting  (PMF) and Isotope Coded Affinity Tags (ICAT)
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)
 

Más de Waters Corporation - Food QC, Safety & Research

Más de Waters Corporation - Food QC, Safety & Research (11)

Oasis® Prime HLB - introducing a new sorbent for the sample cleanup of Food m...
Oasis® Prime HLB - introducing a new sorbent for the sample cleanup of Food m...Oasis® Prime HLB - introducing a new sorbent for the sample cleanup of Food m...
Oasis® Prime HLB - introducing a new sorbent for the sample cleanup of Food m...
 
Stevia - Analytical LC/MS methods from research to routine - Waters Corporati...
Stevia - Analytical LC/MS methods from research to routine - Waters Corporati...Stevia - Analytical LC/MS methods from research to routine - Waters Corporati...
Stevia - Analytical LC/MS methods from research to routine - Waters Corporati...
 
Routine Quantification of Pesticides in Food Matrices using UPLC APGC-MSMS - ...
Routine Quantification of Pesticides in Food Matrices using UPLC APGC-MSMS - ...Routine Quantification of Pesticides in Food Matrices using UPLC APGC-MSMS - ...
Routine Quantification of Pesticides in Food Matrices using UPLC APGC-MSMS - ...
 
Foodomics Applications with High Resolution MS - Waters Corporation Food Res...
Foodomics Applications with High Resolution MS -  Waters Corporation Food Res...Foodomics Applications with High Resolution MS -  Waters Corporation Food Res...
Foodomics Applications with High Resolution MS - Waters Corporation Food Res...
 
Food Contact Materials: Migration testing using MS - Waters Corporation Food ...
Food Contact Materials: Migration testing using MS - Waters Corporation Food ...Food Contact Materials: Migration testing using MS - Waters Corporation Food ...
Food Contact Materials: Migration testing using MS - Waters Corporation Food ...
 
Rapid Analysis of Bisphenols (BP) A, B & E in Baby Food and Infant Formula - ...
Rapid Analysis of Bisphenols (BP) A, B & E in Baby Food and Infant Formula - ...Rapid Analysis of Bisphenols (BP) A, B & E in Baby Food and Infant Formula - ...
Rapid Analysis of Bisphenols (BP) A, B & E in Baby Food and Infant Formula - ...
 
An Integrated Strategy for Natural Biotoxin analysis - Waters Corporation - F...
An Integrated Strategy for Natural Biotoxin analysis - Waters Corporation - F...An Integrated Strategy for Natural Biotoxin analysis - Waters Corporation - F...
An Integrated Strategy for Natural Biotoxin analysis - Waters Corporation - F...
 
Ion Mobility MS for the troubleshooting of methods for Trace Residue Quantita...
Ion Mobility MS for the troubleshooting of methods for Trace Residue Quantita...Ion Mobility MS for the troubleshooting of methods for Trace Residue Quantita...
Ion Mobility MS for the troubleshooting of methods for Trace Residue Quantita...
 
Use of APGC coupled to Tandem Quadrupole Mass Spectrometry for the analysis o...
Use of APGC coupled to Tandem Quadrupole Mass Spectrometry for the analysis o...Use of APGC coupled to Tandem Quadrupole Mass Spectrometry for the analysis o...
Use of APGC coupled to Tandem Quadrupole Mass Spectrometry for the analysis o...
 
The Advantages of Mass Detection for the Food Testing Laboratory - Waters Cor...
The Advantages of Mass Detection for the Food Testing Laboratory - Waters Cor...The Advantages of Mass Detection for the Food Testing Laboratory - Waters Cor...
The Advantages of Mass Detection for the Food Testing Laboratory - Waters Cor...
 
Routine Quantification of Lipophilic Marine Biotoxins in Shellfish by LC/MS/M...
Routine Quantification of Lipophilic Marine Biotoxins in Shellfish by LC/MS/M...Routine Quantification of Lipophilic Marine Biotoxins in Shellfish by LC/MS/M...
Routine Quantification of Lipophilic Marine Biotoxins in Shellfish by LC/MS/M...
 

Último

Botany 4th semester series (krishna).pdf
Botany 4th semester series (krishna).pdfBotany 4th semester series (krishna).pdf
Botany 4th semester series (krishna).pdfSumit Kumar yadav
 
Chemistry 4th semester series (krishna).pdf
Chemistry 4th semester series (krishna).pdfChemistry 4th semester series (krishna).pdf
Chemistry 4th semester series (krishna).pdfSumit Kumar yadav
 
GFP in rDNA Technology (Biotechnology).pptx
GFP in rDNA Technology (Biotechnology).pptxGFP in rDNA Technology (Biotechnology).pptx
GFP in rDNA Technology (Biotechnology).pptxAleenaTreesaSaji
 
SOLUBLE PATTERN RECOGNITION RECEPTORS.pptx
SOLUBLE PATTERN RECOGNITION RECEPTORS.pptxSOLUBLE PATTERN RECOGNITION RECEPTORS.pptx
SOLUBLE PATTERN RECOGNITION RECEPTORS.pptxkessiyaTpeter
 
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...jana861314
 
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...ssifa0344
 
Isotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on IoIsotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on IoSérgio Sacani
 
Recombination DNA Technology (Nucleic Acid Hybridization )
Recombination DNA Technology (Nucleic Acid Hybridization )Recombination DNA Technology (Nucleic Acid Hybridization )
Recombination DNA Technology (Nucleic Acid Hybridization )aarthirajkumar25
 
9654467111 Call Girls In Raj Nagar Delhi Short 1500 Night 6000
9654467111 Call Girls In Raj Nagar Delhi Short 1500 Night 60009654467111 Call Girls In Raj Nagar Delhi Short 1500 Night 6000
9654467111 Call Girls In Raj Nagar Delhi Short 1500 Night 6000Sapana Sha
 
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43bNightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43bSérgio Sacani
 
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...Sérgio Sacani
 
Presentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptxPresentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptxgindu3009
 
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCRStunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCRDelhi Call girls
 
Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)PraveenaKalaiselvan1
 
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral AnalysisRaman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral AnalysisDiwakar Mishra
 
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdfPests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdfPirithiRaju
 
Biopesticide (2).pptx .This slides helps to know the different types of biop...
Biopesticide (2).pptx  .This slides helps to know the different types of biop...Biopesticide (2).pptx  .This slides helps to know the different types of biop...
Biopesticide (2).pptx .This slides helps to know the different types of biop...RohitNehra6
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksSérgio Sacani
 

Último (20)

Botany 4th semester series (krishna).pdf
Botany 4th semester series (krishna).pdfBotany 4th semester series (krishna).pdf
Botany 4th semester series (krishna).pdf
 
Chemistry 4th semester series (krishna).pdf
Chemistry 4th semester series (krishna).pdfChemistry 4th semester series (krishna).pdf
Chemistry 4th semester series (krishna).pdf
 
GFP in rDNA Technology (Biotechnology).pptx
GFP in rDNA Technology (Biotechnology).pptxGFP in rDNA Technology (Biotechnology).pptx
GFP in rDNA Technology (Biotechnology).pptx
 
SOLUBLE PATTERN RECOGNITION RECEPTORS.pptx
SOLUBLE PATTERN RECOGNITION RECEPTORS.pptxSOLUBLE PATTERN RECOGNITION RECEPTORS.pptx
SOLUBLE PATTERN RECOGNITION RECEPTORS.pptx
 
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
 
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
 
Isotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on IoIsotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on Io
 
Recombination DNA Technology (Nucleic Acid Hybridization )
Recombination DNA Technology (Nucleic Acid Hybridization )Recombination DNA Technology (Nucleic Acid Hybridization )
Recombination DNA Technology (Nucleic Acid Hybridization )
 
9654467111 Call Girls In Raj Nagar Delhi Short 1500 Night 6000
9654467111 Call Girls In Raj Nagar Delhi Short 1500 Night 60009654467111 Call Girls In Raj Nagar Delhi Short 1500 Night 6000
9654467111 Call Girls In Raj Nagar Delhi Short 1500 Night 6000
 
CELL -Structural and Functional unit of life.pdf
CELL -Structural and Functional unit of life.pdfCELL -Structural and Functional unit of life.pdf
CELL -Structural and Functional unit of life.pdf
 
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43bNightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
 
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
 
Presentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptxPresentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptx
 
The Philosophy of Science
The Philosophy of ScienceThe Philosophy of Science
The Philosophy of Science
 
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCRStunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
 
Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)
 
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral AnalysisRaman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
 
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdfPests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
 
Biopesticide (2).pptx .This slides helps to know the different types of biop...
Biopesticide (2).pptx  .This slides helps to know the different types of biop...Biopesticide (2).pptx  .This slides helps to know the different types of biop...
Biopesticide (2).pptx .This slides helps to know the different types of biop...
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disks
 

Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research

  • 1. ©2015 Waters Corporation 1 Identification of Meat Species in Processed Foods using Mass Spectrometry
  • 2. ©2015 Waters Corporation 2 Presentation Overview  Background – Food labelling regulations – Water retaining agents in chicken products – Use of gelatine  Research Objectives  Proposed solution – Sample preparation procedure – LC-MS approach – Data interpretation  Results – Identification of potential peptide markers – Quantification of markers  Future work using Xevo TQ-S  Conclusions
  • 3. ©2015 Waters Corporation 3 Meat speciation – regulatory requirements  Authenticity of food and the accuracy of package labeling is important to both consumers and food producers  Within the EC food labeling regulations exist – ~5 M people in UK have preferences concerning consumption of certain species  Composition of injection powders? – Undeclared water-retaining hydrolysed proteins from pork and beef used in chicken products – Some chicken products potentially unsuitable for consumers  Need to verify the species of gelatine used in food
  • 4. ©2015 Waters Corporation 4 Injection powders - gelatine  What is it? – Bi-product from the meat / fish industry – partial hydrolysis of collagen extracted from skin, bones, connective tissue  Properties of gelatine – Gelling agent – Semi-solid colloid gel – Texture enhancer  Approx annual production: – Europe: 117kt (70% used in food)  What is it used for? – Food and Beverages – Drugs and capsules – Cosmetics – Photographic film – Fertilisers…
  • 5. ©2015 Waters Corporation 5 Research objectives and aims  Develop a method to detect species and tissue origin of meat ingredients present in meat products 1. To identify unequivocal markers that can indicate the presence of bovine or porcine gelatine 2. To determine whether chicken products have been adulterated with proteins from other animal species 3. To develop a robust and transferable method  Current limitations… – Paper trail is not sufficient – FSA concluded that PCR / IA based strategies are not reliable • DNA markers damaged by processing conditions • False negative rate  Possible Solutions? – LC-MS/MS using a proteomic workflow
  • 6. ©2015 Waters Corporation 6 Alternative strategy = proteomic based analytical strategy to identify peptide markers using HR-MS
  • 7. ©2015 Waters Corporation 7 Bottom-up proteomic experiment 1. Enzyme digestion 2. UPLC separation Precursor ions MSE product ions 3. MS analysis 4. Data interpretation
  • 8. ©2015 Waters Corporation 8 Meat Speciation Workflow SAMPLE PREPARATION (1) Tryptic digest (2) ADH addition DATA ACQUISITION Acquire data-independent MSE Data SOFTWARE PROCESSING IdentityE and gelatine database (BioArch) ANALYTICAL SYSTEMS (1) nanoACQUITY UPLC ® (2) XevoTM QTof MS Nano-scale separations •Resolution •Peak shape •Number of components / analytical run Full scan, accurate mass
  • 9. ©2015 Waters Corporation 9 Meat Speciation Workflow Sample Preparation  Samples – Protein tryptic digests; o pork gelatine o beef gelatine o pork & beef gelatine mix  Tryptic digest – 250 μg of porcine and bovine gelatine were hydrolysed with 5 μg of sequence grade trypsin for 16hr  ADH addition – Quench reaction with formic acid – 10 fmol of yeast alcohol dehydrogenase (internal standard) added tryptic digest SAMPLE PREPARATION (1) Tryptic digest (2) ADH addition
  • 10. ©2015 Waters Corporation 10 UPLC Conditions  System – NanoACQUITY® UPLC  Column: – 75 µm x 15 cm BEH C18 column  Gradient: – 1 to 40% acetonitrile – 90 min  Flow rate: – 300 nL/min  Triplicate analysis MS Conditions  System – Xevo QTof MS  Mass range: – m/z 50-1990  Data Acquisition: – MSE  Collision energy: – Low energy - 4 eV – High energy - 12-35 eV  Acquisition scan time: – 0.9 s/function Meat Speciation Workflow UPLC-MS conditions OPTIMISED ANALYTICAL PARAMETERS (1) nanoACQUITY UPLC ® (2) XevoTM QTof MS
  • 11. ©2015 Waters Corporation 11 Meat Speciation Workflow MSE  UPLC-MSE is a data independent parallel process that occurs in the collision cell  The instrument is operated in an alternative scanning mode providing two MS scan functions for data acquisition in one analytical run – Function 1 = low collision energy (precursor ions) Function 2 = high energy (fragment ions) DATA ACQUISITION Acquire data-independent MSE Data
  • 12. ©2015 Waters Corporation 12 Meat Speciation Workflow Software processing SOFTWARE PROCESSING PLGS and IdentityE Positive matches referenced to database library Increasing confidence in assignment of peptides
  • 13. ©2015 Waters Corporation 13 Results and Discussion
  • 14. ©2015 Waters Corporation 14 nanoACQUITY replicate injections (n=3) Beef gelatine Repeatable results Overlay low energy MSE chromatograms
  • 15. ©2015 Waters Corporation 15 Meat Speciation Workflow Software processing High energy product ion data gives increased confidence in peptide sequence identification Low energy data can be displayed as a mass spectrum or a chromatogram Markers originated from a SINGLE protein Unique marker peptides sequences listed here
  • 16. ©2015 Waters Corporation 16 Discovery & Identification Total Marker Peptides Aim to obtain a peptide marker that is unmodified (if possible)  Over 60 collagen peptides were identified in samples of both bovine and porcine gelatines  IdentityE did not identify peptides from any other proteins – Collagen – Yeast ADH  Indicates the samples were 100% gelatine Multiple forms of the peptides identified Species peptide Peptide mass Type of peptide modification Bovine GYPGNPGPAGAAGAP 1235.58 Non-tryptic cleavage product GYPGNPGPAGAAGAPGPQGAVGPAGK 2173.08 Unmodified peptide GYPGNPGPAGAAGAPGPQGAVGPAGK 2189.07 Hydroxyl of single proline GYPGNPGPAGAAGAPGPQGAVGPAGK 2205.07 Hydroxylation of prolines 3 and 15 GYPGNPGPAGAAGAPGPQGAVGPAGK 2221.06 Three hydroxyprolines GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2653.3 Missed tryptic cleavage hydroxylation of proline 29 GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2669.29 Missed cleavage plus two proline hydroxylations Porcine IGQPGAVGPAGIR 1192.68 Deamidation + Q3 IGQPGAVGPAGIR 1193.66 Hydroxyl + DKNP 4 IGQPGAVGPAGIR 1208.67 IGQPGAVGPAGIR 1209.66 Deamidation +Q3; Hydroxyl+DKNP9
  • 17. ©2015 Waters Corporation 17 Discovery & Identification Unique Unmodified Marker Peptides Bovine peptide marker IGQPGAVAPAGIR Porcine peptide marker TGQPGAVAPAGIR Comparison of high energy MSE fragment ion spectra Differences in b and y ions formed
  • 18. ©2015 Waters Corporation 18 Quantification Porcine and bovine gelatine  Use of ADH enabled quantification of proteins in sample Removes need to use labelling systems for peptide and protein quantification Test mix was prepared Addition of 15%(w/w) bovine gelatine in porcine gelatine Results Three bovine and porcine peptides were selected - relative bovine gelatine content of ~ 16.8%
  • 19. ©2015 Waters Corporation 19 Conclusions  Highly processed food proteins, such as gelatine, that are devoid of DNA signature can be speciated using LC-MS  Protein sequence database analysis identified peptide sequences within the protein that are species specific  Waters Xevo Qtof MS was able to identify these sequences, even after significant modification of the amino acids  The interrogation of the total protein complement of the sample also provided potential information on non-gelatine proteins in the samples
  • 20. ©2015 Waters Corporation 20 Further Work Preliminary data suggests the method can be used to quantify the species in mixtures of gelatines  Investigate the contribution that type III collagen (from skin and connective tissue) might make to the quantitative analysis of gelatines
  • 21. ©2015 Waters Corporation 21 Future Work Method transfer to routine analysis using tandem quad MS/MS
  • 22. ©2015 Waters Corporation 22 Acknowledgments Helen Grundy - Food and Environment Research Agency, York, UK BioArCh, University of York, UK Thank you for your attention Any Questions?