SlideShare una empresa de Scribd logo
1 de 20
What should be the time interval for a  booster vaccination following re-exposure to rabies in previously vaccinated individuals ? Dr. M. K. Sudarshan ,  MBBS,   MD [BHU], FAMS, Hon. FFPH [UK] Dean/Principal and Professor of Community Medicine President,  Rabies in Asia Foundation Kempegowda Institute of Medical Sciences Bangalore, India Email: mksudarshan@gmail.com
Introduction  ,[object Object],[object Object]
Introduction ,[object Object],[object Object],[object Object],[object Object],[object Object]
Introduction ,[object Object],[object Object],[object Object]
Materials and Method ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
CRITERION  ,[object Object],[object Object]
Results Table 1. Antibody response to PEP immunization Note: 0.07% and 0.14% of  rabies exposed persons had inadequate (<0.5IU/mL) RVNA  response at the  end of first and third month post-primary PEP, with or without RIG. Route of administration of Vaccine Enrolment/ Recruitment RIGs used Vaccinees  with inadequate  antibody response Cohorts Subjects /Patients Cohorts Subjects / Patients Day  28 Day 90 Day 180 Day  365 Total Intramuscular Intradermal 23 1314 12 636 0/1238 0/1051 3 /670 9/99 12 32 1481 17 690 2 /1268 4 /1366 3 /719 37/558 46 Total 55 2795 29 1326 2 /2506 4 /2417 6 /1389 46/657 58
Table  2. Antibody response to PrEP vaccination Note: All had adequate (≥0.5 IU per mL) RVNA response up to three months post   primary PrEP vaccination. Route of administration of Vaccine Enrolment/ Recruitment Vaccinees  with inadequate  antibody response Cohorts Subjects /Patients Day  28 Day 90 Day 180 Day  365 Total Intramuscular  8 518 0/263 0/33 4 / 37 12/ 209 16 Intradermal 3 59 0/59 0/59 0/33 0/59 - Total 11 577 0/322 0/92 4 /70 12/268 16
Discussion  ,[object Object],[object Object],[object Object],[object Object],[object Object]
Conclusion  ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Reference ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object],[object Object]
[object Object],[object Object],[object Object]
Asian Biomedicine Vol  5, No 5, October 2011: 589-593
Thank you for your kind attention Taj Mahal, India

Más contenido relacionado

La actualidad más candente

Evaluating the impact of a new MenB vaccine and use of MRF genome library
Evaluating the impact of a new MenB vaccine and use of MRF genome libraryEvaluating the impact of a new MenB vaccine and use of MRF genome library
Evaluating the impact of a new MenB vaccine and use of MRF genome libraryMeningitis Research Foundation
 
Acellular pertussis v/s wP - Current status
Acellular pertussis v/s wP - Current statusAcellular pertussis v/s wP - Current status
Acellular pertussis v/s wP - Current statusGaurav Gupta
 
Shifting paradigms in vaccinology immune modulation and sex differences explo...
Shifting paradigms in vaccinology immune modulation and sex differences explo...Shifting paradigms in vaccinology immune modulation and sex differences explo...
Shifting paradigms in vaccinology immune modulation and sex differences explo...WAidid
 
Clin infect dis 2015-martínez-bonet-1169-78
Clin infect dis  2015-martínez-bonet-1169-78Clin infect dis  2015-martínez-bonet-1169-78
Clin infect dis 2015-martínez-bonet-1169-78Alex Castañeda-Sabogal
 
The new generation indian tcv - Zyvac TCV by Zydus Vaccines
The new generation indian tcv - Zyvac TCV by Zydus VaccinesThe new generation indian tcv - Zyvac TCV by Zydus Vaccines
The new generation indian tcv - Zyvac TCV by Zydus VaccinesGaurav Gupta
 
RVGE & vaccination, Indian data with reference to 116E
RVGE & vaccination, Indian data with reference to 116ERVGE & vaccination, Indian data with reference to 116E
RVGE & vaccination, Indian data with reference to 116EGaurav Gupta
 
Efficacy and safety of immunomodulators in pediatric age - Slideset by Profes...
Efficacy and safety of immunomodulators in pediatric age - Slideset by Profes...Efficacy and safety of immunomodulators in pediatric age - Slideset by Profes...
Efficacy and safety of immunomodulators in pediatric age - Slideset by Profes...WAidid
 
Issues in evaluating the impact of a new meningococcal B vaccine
Issues in evaluating the impact of a new meningococcal B vaccineIssues in evaluating the impact of a new meningococcal B vaccine
Issues in evaluating the impact of a new meningococcal B vaccineMeningitis Research Foundation
 
Typhoid conjugate vaccine use on adults and children
Typhoid conjugate vaccine use on adults and childrenTyphoid conjugate vaccine use on adults and children
Typhoid conjugate vaccine use on adults and childrenhillemanlabs
 
Non-routine use of meningococcal vaccines in outbreaks and for individuals wi...
Non-routine use of meningococcal vaccines in outbreaks and for individuals wi...Non-routine use of meningococcal vaccines in outbreaks and for individuals wi...
Non-routine use of meningococcal vaccines in outbreaks and for individuals wi...Meningitis Research Foundation
 
OM-85 Applicability in routine clinical practice - Professor Susanna Esposito
OM-85 Applicability in routine clinical practice - Professor Susanna EspositoOM-85 Applicability in routine clinical practice - Professor Susanna Esposito
OM-85 Applicability in routine clinical practice - Professor Susanna EspositoWAidid
 
Seminario Biología Molecular
Seminario Biología MolecularSeminario Biología Molecular
Seminario Biología Molecularmateomejia9
 
Priorix tetra – global experience and local evidence - Mohali march 2017
Priorix tetra – global experience and local evidence - Mohali march 2017Priorix tetra – global experience and local evidence - Mohali march 2017
Priorix tetra – global experience and local evidence - Mohali march 2017Gaurav Gupta
 
Human vaccinations in egypt 2021
Human vaccinations in egypt   2021Human vaccinations in egypt   2021
Human vaccinations in egypt 2021HusseinAbass1
 

La actualidad más candente (20)

Adverse reactions to vaccines practice parameter 2012 update
Adverse reactions to vaccines practice parameter 2012 updateAdverse reactions to vaccines practice parameter 2012 update
Adverse reactions to vaccines practice parameter 2012 update
 
Adverse reactions to vaccines for infectious diseases
Adverse reactions to vaccines for infectious diseasesAdverse reactions to vaccines for infectious diseases
Adverse reactions to vaccines for infectious diseases
 
JVCI recommendation on Men vaccine
JVCI recommendation on Men vaccineJVCI recommendation on Men vaccine
JVCI recommendation on Men vaccine
 
Evaluating the impact of a new MenB vaccine and use of MRF genome library
Evaluating the impact of a new MenB vaccine and use of MRF genome libraryEvaluating the impact of a new MenB vaccine and use of MRF genome library
Evaluating the impact of a new MenB vaccine and use of MRF genome library
 
Acellular pertussis v/s wP - Current status
Acellular pertussis v/s wP - Current statusAcellular pertussis v/s wP - Current status
Acellular pertussis v/s wP - Current status
 
Shifting paradigms in vaccinology immune modulation and sex differences explo...
Shifting paradigms in vaccinology immune modulation and sex differences explo...Shifting paradigms in vaccinology immune modulation and sex differences explo...
Shifting paradigms in vaccinology immune modulation and sex differences explo...
 
Clin infect dis 2015-martínez-bonet-1169-78
Clin infect dis  2015-martínez-bonet-1169-78Clin infect dis  2015-martínez-bonet-1169-78
Clin infect dis 2015-martínez-bonet-1169-78
 
The new generation indian tcv - Zyvac TCV by Zydus Vaccines
The new generation indian tcv - Zyvac TCV by Zydus VaccinesThe new generation indian tcv - Zyvac TCV by Zydus Vaccines
The new generation indian tcv - Zyvac TCV by Zydus Vaccines
 
Adverse reactions to vaccine for infectious diseases
Adverse reactions to vaccine for infectious diseasesAdverse reactions to vaccine for infectious diseases
Adverse reactions to vaccine for infectious diseases
 
RVGE & vaccination, Indian data with reference to 116E
RVGE & vaccination, Indian data with reference to 116ERVGE & vaccination, Indian data with reference to 116E
RVGE & vaccination, Indian data with reference to 116E
 
Efficacy and safety of immunomodulators in pediatric age - Slideset by Profes...
Efficacy and safety of immunomodulators in pediatric age - Slideset by Profes...Efficacy and safety of immunomodulators in pediatric age - Slideset by Profes...
Efficacy and safety of immunomodulators in pediatric age - Slideset by Profes...
 
Issues in evaluating the impact of a new meningococcal B vaccine
Issues in evaluating the impact of a new meningococcal B vaccineIssues in evaluating the impact of a new meningococcal B vaccine
Issues in evaluating the impact of a new meningococcal B vaccine
 
Allergic Reactions to mRNA COVID-19 Vaccines.pptx
Allergic Reactions to mRNA COVID-19 Vaccines.pptxAllergic Reactions to mRNA COVID-19 Vaccines.pptx
Allergic Reactions to mRNA COVID-19 Vaccines.pptx
 
Typhoid conjugate vaccine use on adults and children
Typhoid conjugate vaccine use on adults and childrenTyphoid conjugate vaccine use on adults and children
Typhoid conjugate vaccine use on adults and children
 
Non-routine use of meningococcal vaccines in outbreaks and for individuals wi...
Non-routine use of meningococcal vaccines in outbreaks and for individuals wi...Non-routine use of meningococcal vaccines in outbreaks and for individuals wi...
Non-routine use of meningococcal vaccines in outbreaks and for individuals wi...
 
OM-85 Applicability in routine clinical practice - Professor Susanna Esposito
OM-85 Applicability in routine clinical practice - Professor Susanna EspositoOM-85 Applicability in routine clinical practice - Professor Susanna Esposito
OM-85 Applicability in routine clinical practice - Professor Susanna Esposito
 
Seminario Biología Molecular
Seminario Biología MolecularSeminario Biología Molecular
Seminario Biología Molecular
 
Vaccine allergy
Vaccine allergy Vaccine allergy
Vaccine allergy
 
Priorix tetra – global experience and local evidence - Mohali march 2017
Priorix tetra – global experience and local evidence - Mohali march 2017Priorix tetra – global experience and local evidence - Mohali march 2017
Priorix tetra – global experience and local evidence - Mohali march 2017
 
Human vaccinations in egypt 2021
Human vaccinations in egypt   2021Human vaccinations in egypt   2021
Human vaccinations in egypt 2021
 

Similar a Dr.MK Sudarshan

Rotavirus vaccine presentation Rotateq 28 june 2013
Rotavirus vaccine presentation Rotateq   28 june 2013Rotavirus vaccine presentation Rotateq   28 june 2013
Rotavirus vaccine presentation Rotateq 28 june 2013Gaurav Gupta
 
Immunisation programme.pptx
Immunisation programme.pptxImmunisation programme.pptx
Immunisation programme.pptxssuser38ed4c2
 
Vaccine recommendations in children with rheumatological diseases
Vaccine recommendations in children with rheumatological diseasesVaccine recommendations in children with rheumatological diseases
Vaccine recommendations in children with rheumatological diseasesdattasrisaila
 
Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017Gaurav Gupta
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxjyothi132223
 
Malaria vaccine presentation
Malaria vaccine presentationMalaria vaccine presentation
Malaria vaccine presentationdeluxe1234
 
Preterm Vaccination -Final 1.pptx
Preterm Vaccination -Final 1.pptxPreterm Vaccination -Final 1.pptx
Preterm Vaccination -Final 1.pptxHimanshugupta593316
 
Estimation of Anti Hbs antibody titer in adults during 5-10 years period foll...
Estimation of Anti Hbs antibody titer in adults during 5-10 years period foll...Estimation of Anti Hbs antibody titer in adults during 5-10 years period foll...
Estimation of Anti Hbs antibody titer in adults during 5-10 years period foll...IOSR Journals
 
Vaccine clinical trial
Vaccine clinical trialVaccine clinical trial
Vaccine clinical trialPiyush Bafna
 
Potential advantages of booster containing PCV regimen - Professor Shabir Madhi
Potential advantages of booster containing PCV regimen - Professor Shabir MadhiPotential advantages of booster containing PCV regimen - Professor Shabir Madhi
Potential advantages of booster containing PCV regimen - Professor Shabir MadhiWAidid
 
Dr Muhamed-Kheir Taha @ MRF's Meningitis and Septicaemia 2019
Dr Muhamed-Kheir Taha @ MRF's Meningitis and Septicaemia 2019Dr Muhamed-Kheir Taha @ MRF's Meningitis and Septicaemia 2019
Dr Muhamed-Kheir Taha @ MRF's Meningitis and Septicaemia 2019Meningitis Research Foundation
 
A controlled trial for safety and immunogenicity Of Zika purified inactivated...
A controlled trial for safety and immunogenicity Of Zika purified inactivated...A controlled trial for safety and immunogenicity Of Zika purified inactivated...
A controlled trial for safety and immunogenicity Of Zika purified inactivated...ShaistaAhmed8
 
Current challenges in pertussis prevention gaurav gupta - sept 2016
Current challenges in pertussis prevention   gaurav gupta - sept 2016Current challenges in pertussis prevention   gaurav gupta - sept 2016
Current challenges in pertussis prevention gaurav gupta - sept 2016Gaurav Gupta
 
New covid 19 vaccines and trials
New covid 19 vaccines and trialsNew covid 19 vaccines and trials
New covid 19 vaccines and trialsKarthik2205
 
New Vaccines in the immediate pipeline - Slideset by Professor Susanna Esposito
New Vaccines in the immediate pipeline - Slideset by Professor Susanna EspositoNew Vaccines in the immediate pipeline - Slideset by Professor Susanna Esposito
New Vaccines in the immediate pipeline - Slideset by Professor Susanna EspositoWAidid
 
Katie Flanagan - Malaria vaccines current status and challenges
Katie Flanagan - Malaria vaccines current status and challengesKatie Flanagan - Malaria vaccines current status and challenges
Katie Flanagan - Malaria vaccines current status and challengesWAidid
 

Similar a Dr.MK Sudarshan (20)

Rotavirus vaccine presentation Rotateq 28 june 2013
Rotavirus vaccine presentation Rotateq   28 june 2013Rotavirus vaccine presentation Rotateq   28 june 2013
Rotavirus vaccine presentation Rotateq 28 june 2013
 
Immunisation programme.pptx
Immunisation programme.pptxImmunisation programme.pptx
Immunisation programme.pptx
 
Vaccine recommendations in children with rheumatological diseases
Vaccine recommendations in children with rheumatological diseasesVaccine recommendations in children with rheumatological diseases
Vaccine recommendations in children with rheumatological diseases
 
Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017
 
OSCE on Rabies.. Dr.Padmesh
OSCE on Rabies.. Dr.PadmeshOSCE on Rabies.. Dr.Padmesh
OSCE on Rabies.. Dr.Padmesh
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
 
Malaria vaccine presentation
Malaria vaccine presentationMalaria vaccine presentation
Malaria vaccine presentation
 
Preterm Vaccination -Final 1.pptx
Preterm Vaccination -Final 1.pptxPreterm Vaccination -Final 1.pptx
Preterm Vaccination -Final 1.pptx
 
Estimation of Anti Hbs antibody titer in adults during 5-10 years period foll...
Estimation of Anti Hbs antibody titer in adults during 5-10 years period foll...Estimation of Anti Hbs antibody titer in adults during 5-10 years period foll...
Estimation of Anti Hbs antibody titer in adults during 5-10 years period foll...
 
Vaccine clinical trial
Vaccine clinical trialVaccine clinical trial
Vaccine clinical trial
 
Potential advantages of booster containing PCV regimen - Professor Shabir Madhi
Potential advantages of booster containing PCV regimen - Professor Shabir MadhiPotential advantages of booster containing PCV regimen - Professor Shabir Madhi
Potential advantages of booster containing PCV regimen - Professor Shabir Madhi
 
Meningitis Vaccines
Meningitis VaccinesMeningitis Vaccines
Meningitis Vaccines
 
Dr Muhamed-Kheir Taha @ MRF's Meningitis and Septicaemia 2019
Dr Muhamed-Kheir Taha @ MRF's Meningitis and Septicaemia 2019Dr Muhamed-Kheir Taha @ MRF's Meningitis and Septicaemia 2019
Dr Muhamed-Kheir Taha @ MRF's Meningitis and Septicaemia 2019
 
Adult vaccination
Adult vaccinationAdult vaccination
Adult vaccination
 
A controlled trial for safety and immunogenicity Of Zika purified inactivated...
A controlled trial for safety and immunogenicity Of Zika purified inactivated...A controlled trial for safety and immunogenicity Of Zika purified inactivated...
A controlled trial for safety and immunogenicity Of Zika purified inactivated...
 
Current challenges in pertussis prevention gaurav gupta - sept 2016
Current challenges in pertussis prevention   gaurav gupta - sept 2016Current challenges in pertussis prevention   gaurav gupta - sept 2016
Current challenges in pertussis prevention gaurav gupta - sept 2016
 
New covid 19 vaccines and trials
New covid 19 vaccines and trialsNew covid 19 vaccines and trials
New covid 19 vaccines and trials
 
New Vaccines in the immediate pipeline - Slideset by Professor Susanna Esposito
New Vaccines in the immediate pipeline - Slideset by Professor Susanna EspositoNew Vaccines in the immediate pipeline - Slideset by Professor Susanna Esposito
New Vaccines in the immediate pipeline - Slideset by Professor Susanna Esposito
 
Human parasite vaccines
Human parasite vaccinesHuman parasite vaccines
Human parasite vaccines
 
Katie Flanagan - Malaria vaccines current status and challenges
Katie Flanagan - Malaria vaccines current status and challengesKatie Flanagan - Malaria vaccines current status and challenges
Katie Flanagan - Malaria vaccines current status and challenges
 

Último

The Most Attractive Hyderabad Call Girls Kothapet 𖠋 6297143586 𖠋 Will You Mis...
The Most Attractive Hyderabad Call Girls Kothapet 𖠋 6297143586 𖠋 Will You Mis...The Most Attractive Hyderabad Call Girls Kothapet 𖠋 6297143586 𖠋 Will You Mis...
The Most Attractive Hyderabad Call Girls Kothapet 𖠋 6297143586 𖠋 Will You Mis...chandars293
 
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...narwatsonia7
 
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore EscortsCall Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escortsvidya singh
 
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...Arohi Goyal
 
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...indiancallgirl4rent
 
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Dipal Arora
 
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...Taniya Sharma
 
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Book Paid Powai Call Girls Mumbai 𖠋 9930245274 𖠋Low Budget Full Independent H...
Book Paid Powai Call Girls Mumbai 𖠋 9930245274 𖠋Low Budget Full Independent H...Book Paid Powai Call Girls Mumbai 𖠋 9930245274 𖠋Low Budget Full Independent H...
Book Paid Powai Call Girls Mumbai 𖠋 9930245274 𖠋Low Budget Full Independent H...Call Girls in Nagpur High Profile
 
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Bangalore Call Girls Nelamangala Number 7001035870 Meetin With Bangalore Esc...
Bangalore Call Girls Nelamangala Number 7001035870  Meetin With Bangalore Esc...Bangalore Call Girls Nelamangala Number 7001035870  Meetin With Bangalore Esc...
Bangalore Call Girls Nelamangala Number 7001035870 Meetin With Bangalore Esc...narwatsonia7
 
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...Taniya Sharma
 
Lucknow Call girls - 8800925952 - 24x7 service with hotel room
Lucknow Call girls - 8800925952 - 24x7 service with hotel roomLucknow Call girls - 8800925952 - 24x7 service with hotel room
Lucknow Call girls - 8800925952 - 24x7 service with hotel roomdiscovermytutordmt
 
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...CALL GIRLS
 
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...jageshsingh5554
 
Russian Escorts Girls Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
Russian Escorts Girls  Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls DelhiRussian Escorts Girls  Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
Russian Escorts Girls Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls DelhiAlinaDevecerski
 
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...narwatsonia7
 

Último (20)

The Most Attractive Hyderabad Call Girls Kothapet 𖠋 6297143586 𖠋 Will You Mis...
The Most Attractive Hyderabad Call Girls Kothapet 𖠋 6297143586 𖠋 Will You Mis...The Most Attractive Hyderabad Call Girls Kothapet 𖠋 6297143586 𖠋 Will You Mis...
The Most Attractive Hyderabad Call Girls Kothapet 𖠋 6297143586 𖠋 Will You Mis...
 
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
 
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
 
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore EscortsCall Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
 
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
 
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
 
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
 
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
 
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
 
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
 
Book Paid Powai Call Girls Mumbai 𖠋 9930245274 𖠋Low Budget Full Independent H...
Book Paid Powai Call Girls Mumbai 𖠋 9930245274 𖠋Low Budget Full Independent H...Book Paid Powai Call Girls Mumbai 𖠋 9930245274 𖠋Low Budget Full Independent H...
Book Paid Powai Call Girls Mumbai 𖠋 9930245274 𖠋Low Budget Full Independent H...
 
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
 
Bangalore Call Girls Nelamangala Number 7001035870 Meetin With Bangalore Esc...
Bangalore Call Girls Nelamangala Number 7001035870  Meetin With Bangalore Esc...Bangalore Call Girls Nelamangala Number 7001035870  Meetin With Bangalore Esc...
Bangalore Call Girls Nelamangala Number 7001035870 Meetin With Bangalore Esc...
 
Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...
Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...
Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...
 
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
 
Lucknow Call girls - 8800925952 - 24x7 service with hotel room
Lucknow Call girls - 8800925952 - 24x7 service with hotel roomLucknow Call girls - 8800925952 - 24x7 service with hotel room
Lucknow Call girls - 8800925952 - 24x7 service with hotel room
 
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
 
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
 
Russian Escorts Girls Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
Russian Escorts Girls  Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls DelhiRussian Escorts Girls  Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
Russian Escorts Girls Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
 
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 8250192130 ⟟ Call Me For Gen...
 

Dr.MK Sudarshan

  • 1. What should be the time interval for a booster vaccination following re-exposure to rabies in previously vaccinated individuals ? Dr. M. K. Sudarshan , MBBS, MD [BHU], FAMS, Hon. FFPH [UK] Dean/Principal and Professor of Community Medicine President, Rabies in Asia Foundation Kempegowda Institute of Medical Sciences Bangalore, India Email: mksudarshan@gmail.com
  • 2.
  • 3.
  • 4.
  • 5.
  • 6.
  • 7. Results Table 1. Antibody response to PEP immunization Note: 0.07% and 0.14% of rabies exposed persons had inadequate (<0.5IU/mL) RVNA response at the end of first and third month post-primary PEP, with or without RIG. Route of administration of Vaccine Enrolment/ Recruitment RIGs used Vaccinees with inadequate antibody response Cohorts Subjects /Patients Cohorts Subjects / Patients Day 28 Day 90 Day 180 Day 365 Total Intramuscular Intradermal 23 1314 12 636 0/1238 0/1051 3 /670 9/99 12 32 1481 17 690 2 /1268 4 /1366 3 /719 37/558 46 Total 55 2795 29 1326 2 /2506 4 /2417 6 /1389 46/657 58
  • 8. Table 2. Antibody response to PrEP vaccination Note: All had adequate (≥0.5 IU per mL) RVNA response up to three months post primary PrEP vaccination. Route of administration of Vaccine Enrolment/ Recruitment Vaccinees with inadequate antibody response Cohorts Subjects /Patients Day 28 Day 90 Day 180 Day 365 Total Intramuscular 8 518 0/263 0/33 4 / 37 12/ 209 16 Intradermal 3 59 0/59 0/59 0/33 0/59 - Total 11 577 0/322 0/92 4 /70 12/268 16
  • 9.
  • 10.
  • 11.
  • 12.
  • 13.
  • 14.
  • 15.
  • 16.
  • 17.
  • 18.
  • 19. Asian Biomedicine Vol 5, No 5, October 2011: 589-593
  • 20. Thank you for your kind attention Taj Mahal, India