SlideShare una empresa de Scribd logo
1 de 7
Descargar para leer sin conexión
Photochemical Micropatterning of Carbohydrates on a Surface
Gregory T. Carroll,† Denong Wang,‡ Nicholas J. Turro,†,§ and Jeffrey T. Koberstein*,§
Department of Chemistry, Columbia UniVersity, 3000 Broadway, MC 3157, 10027, New York, New York,
Carbohydrate Microarray Laboratory, Departments of Genetics, Neurology, and Neurological Sciences,
Stanford UniVersity School of Medicine, Beckman Center B007, 94305, Stanford, California, and
Department of Chemical Engineering, Columbia UniVersity, 500 West 120th Street, 10027,
New York, New York 10027
ReceiVed NoVember 16, 2005. In Final Form: January 9, 2006
In this report, we demonstrate a versatile method for the immobilization and patterning of unmodified carbohydrates
onto glass substrates. The method employs a novel self-assembled monolayer to present photoactive phthalimide
chromophores at the air-monolayer interface. Upon exposure to UV radiation, the phthalimide end-groups graft to
surface-adsorbed carbohydrates, presumably by a hydrogen abstraction mechanism followed by radical recombination
to form a covalent bond. Immobilized carbohydrate thin films are evidenced by fluorescence, ellipsometry and contact-
angle measurements. Surface micropatterns of mono-, oligo-, and polysaccharides are generated by exposure through
a contact photomask and are visualized by condensing water onto the surface. The efficiency of covalent coupling
is dependent on the thermodynamic state of the surface. The amount of surface-grafted carbohydrate is enhanced when
carbohydrate surface interactions are increased by the incorporation of amine-terminated molecules into the monolayer.
Glass substrates modified with mixed monolayers of this nature are used to construct carbohydrate microarrays by
spotting the carbohydrates with a robot and subsequently illuminating them with UV light to covalently link the
carbohydrates.Surface-immobilizedpolysaccharidesdisplaywell-definedantigenicdeterminantsforantibodyrecognition.
We demonstrate, therefore, that this novel technology combines the ability to create carbohydrate microarrays using
the current state-of-the-art technology of robotic microspotting and the ability to control the shape of immobilized
carbohydrate patterns with a spatial resolution defined by the UV wavelength and a shape defined by a photomask.
Introduction
Carbohydrates, like nucleic acids and proteins, carry important
biological information. The development of high-throughput
technologies for generating DNA and protein microarrays has
been vigorously explored and has contributed greatly to the fields
of genomics and proteomics. A newer field that explores the
information content of carbohydrates, called glycomics, has
recently emerged and has been facilitated by the relatively recent
development of carbohydrate microarrays.1-10 Already, carbo-
hydrate microarrays have been used to investigate the SARS6
and HIV7 viruses. In addition, enzyme activity,3,11 glycome
sequencing,2 and carbohydrate interactions with cells,12,13
antibodies,1 and proteins4,14 have been studied with carbohydrate
microarrays.Immobilizingcarbohydratesonsurfaceshasbecome
a major preliminary challenge in the area. Most current methods
involve either a noncovalent immobilization that becomes less
stable as the molecular weight (MW) decreases, or synthetic
methods in which each carbohydrate to be spotted must first be
chemically modified. To develop a simple and universal approach
to carbohydrate microarray fabrication, it is very important to
devise methods that allow for covalent immobilization of
carbohydrates on a surface without prior chemical derivatization.
Only a few methods have been reported that demonstrate this
goal. Underivatized carbohydrates have been covalently attached
to monolayers bearing phenylboronic acid groups,15 polysac-
charide films bearing diazirine groups,16 and hydrazide-coated
glass slides.17 Only the latter two methods were used to construct
microarrays.
Carbohydrates also contain important physical and chemical
propertiesthatmayfindutilityinbiotechnologyandnoveldevices.
Surface-immobilized carbohydrates are potential components in
biological sensors,18 scaffolds for tissue engineering,19 templates
forstudyingcellbehaviorinaconfinedspace,20 suprabiomolecular
structures on surfaces,21 host-guest complexes on a surface,
* Corresponding author.
† Department of Chemistry, Columbia University.
‡ Stanford University School of Medicine.
§ Department of Chemical Engineering, Columbia University.
(1) Wang, D.; Liu, S.; Trummer, B. J.; Deng, C.; Wang, A. Nat. Biotechnol.
2002, 20 (3), 275-281.
(2) Fukui, S.; Feizi, T.; Galustian, C.; Lawson Alexander, M.; Chai, W. Nat.
Biotechnol. 2002, 20 (10), 1011-1017.
(3) Fazio, F.; Bryan, M. C.; Blixt, O.; Paulson, J. C.; Wong, C.-H. J. Am.
Chem. Soc. 2002, 124 (48), 14397-14402.
(4) Park, S.; Shin, I. Angew. Chem., Int. Ed. 2002, 41 (17), 3180-3182.
(5) Willats, W. G. T.; Rasmussen, S. E.; Kristensen, T.; Mikkelsen, J. D.;
Knox, J. P. Proteomics 2002, 2 (12), 1666-1671.
(6) Wang, D.; Lu, J. Physiol. Genomics 2004, 18 (2), 245-248.
(7) Adams, E. W.; Ratner, D. M.; Bokesch, H. R.; McMahon, J. B.; O’Keefe,
B. R.; Seeberger, P. H. Chem. Biol. 2004, 11 (6), 875-881.
(8) Blixt, O.; Head, S.; Mondala, T.; Scanlan, C.; Huflejt, M. E.; Alvarez, R.;
Bryan, M. C.; Fazio, F.; Calarese, D.; Stevens, J.; Razi, N.; Stevens, D. J.; Skehel,
J. J.; van Die, I.; Burton, D. R.; Wilson, I. A.; Cummings, R.; Bovin, N.; Wong,
C.-H.; Paulson, J. C. Proc. Natl. Acad. Sci. U.S.A. 2004, 101 (49), 17033-17038.
(9) Houseman, B. T.; Mrksich, M. Chem. Biol. 2002, 9 (4), 443-454.
(10) Ko, K.-S.; Jaipuri, F. A.; Pohl, N. L. J. Am. Chem. Soc. 2005, 127 (38),
13162-13163.
(11) Bryan, M. C.; Lee, L. V.; Wong, C.-H. Bioorg. Med. Chem. Lett. 2004,
14 (12), 3185-3188.
(12) Nimrichter, L.; Gargir, A.; Gortler, M.; Altstock, R. T.; Shtevi, A.;
Weisshaus, O.; Fire, E.; Dotan, N.; Schnaar, R. L. Glycobiology 2004, 14 (2),
197-203.
(13) Disney, M. D.; Seeberger, P. H. Chem. Biol. 2004, 11 (12), 1701-1707.
(14) Park, S.; Lee, M.-R.; Pyo, S.-J.; Shin, I. J. Am. Chem. Soc. 2004, 126 (15),
4812-4819.
(15) Takahashi, S.; Anzai, J. Langmuir 2005, 21 (11), 5102-5107.
(16) Angeloni, S.; Ridet, J. L.; Kusy, N.; Gao, H.; Crevoisier, F.; Guinchard,
S.; Kochhar, S.; Sigrist, H.; Sprenger, N. Glycobiology 2005, 15 (1), 31-41.
(17) Lee, M.-R.; Shin, I. Org. Lett. 2005, 7 (19), 4269-4272.
(18) Jelinek, R.; Kolusheva, S. Chem. ReV. 2004, 104 (12), 5987-6015.
(19) Yeong, W.-Y.; Chua, C.-K.; Leong, K.-F.; Chandrasekaran, M. Trends
Biotechnol. 2004, 22 (12), 643-652.
(20) Chen, C. S.; Mrksich, M.; Huang, S.; Whitesides, G. M.; Ingber, D. E.
Science 1997, 276 (5317), 1425-1428.
(21) Liu, G.-Y.; Amro, N. A. Proc. Natl. Acad. Sci. U.S.A. 2002, 99 (8),
5165-5170.
2899Langmuir 2006, 22, 2899-2905
10.1021/la0531042 CCC: $33.50 © 2006 American Chemical Society
Published on Web 02/15/2006
and three-dimensional biochips.22 It is desirable to have spatial
control over surface immobilization when incorporating carbo-
hydrates into many of these devices. One widely accessible
approach involves pattern transfer via a photomask or stamp.
Although patterning biological materials on surfaces using these
versatile approaches has been demonstrated,23,24 there are
relatively few reports focusing on carbohydrates.25
Irradiating photoactive surfaces in the presence of a photo-
mask26 is a well-known technology that employs photons as
traceless reagents for pattern formation without the use of a
spotter, microstamps, or an atomic force microscope and has
been used to control the spatial deposition of various materials
including proteins,27 DNA,28 cells,29 and colloidal and nano-
particles.30 The resolution of such patterns is controlled by the
size of the illumination pattern and is not dependent on the size
of the drop placed on the surface by a spotter. Such features
allow greater control over the size and shape of a micron-sized
architecture. As the size of such patterns continues to decrease,
scaffolds of individual macromolecules could be produced,
allowing for interactions at the single-molecule or few-molecules
level to be interrogated. In addition, reducing the size of the
pattern reduces the amount of material consumed.
In this report, we demonstrate a versatile method for covalent
immobilization and patterning of unmodified mono-, oligo-, and
polysaccharides onto glass substrates. This technology involves
self-assembly of a new class of photoactive monolayers onto
glass substrates. The monolayers present phthalimide chromo-
phores31 at the surface that, upon exposure to light, graft surface
adsorbed carbohydrates by hydrogen abstraction followed by
radical recombination. Using a robotic spotter, we are able to
generate a microarray of carbohydrates and demonstrate high-
throughput characterization of antigen-antibody interactions.
The surface-immobilized carbohydrates retain their immunologi-
calproperties.Incomparisonwithnitrocellulose-coatedsubstrates,
an established technology for carbohydrate microarrays,1,2,6,32
this novel approach is much less dependent on the MW of the
spotted carbohydrates and shows a higher grafting efficiency for
lower MWs. The photochemical patterning method described
herein requires no chemical modification of the sugars prior to
deposition, is applicable for carbohydrates of different MWs,
requires no chemical reagents for covalent coupling of carbo-
hydrates on the surfaces, and uses existing microspotting devices
for high-throughput microarray construction. The methodology
we present has potential applications in materials, biological,
and medical research.
Results and Discussion
To covalently link carbohydrates to a surface without prior
derivatization, we created self-assembled monolayers (SAMs)
containing aromatic carbonyls that can react with C-H groups
upon absorption of a photon to form a covalent bond.33
Phthalimide derivatives can undergo all the major photochemical
reactions of aromatic carbonyls.31 Exposure to UV light produces
an excited n-π* state that can abstract a hydrogen atom from a
nearby molecule. The resulting radicals can then recombine,
forming a covalent bond as shown in Figure 1. Other secondary
processes are also possible, including disproportionation and
back-transfer.CarbohydratesubstratescanundergopH-dependent
and independent rearrangements, depending on the structure of
thecarbohydrate.34 Facileincorporationofpotassiumphthalimide
into bromine-terminated silanes allows for self-assembly on
silicon, glass, or quartz substrates. Terminal groups other than
silanes could readily be employed in the synthesis to create
phthalimides for self-assembly onto other substrates.
To create a novel surface suitable for immobilizing carbo-
hydrates, a phthalimide-derivatized silane was synthesized in
one step by reacting 11-bromoundecanetrimethoxy silane with
potassium phthalimide in dimethylformamide (DMF) to produce
11-phthalimidoundecanetrimethoxy silane (compound 1). Com-
pound 1 was self-assembled on silicon, glass, and quartz in
anhydrous toluene to produce SAM 1 as shown in Figure 2. The
self-assembly of compound 1 on the surface was verified by
UV/Visible (UV-vis) spectroscopy as shown in Figure 3. Under
the rough assumption that the extinction coefficient of the
chromophore on the surface is the same as that in solution, the
approximate surface coverage was calculated to be 5.5 molecules/
nm2.35 A rough calculation using Chem.3D suggests that about
4.9 aliphatic phthalimides can fit in a space of 1 nm2, a value
that is the same order of magnitude as the experimental value,
suggesting that SAM 1 is densely packed. In addition, an H2O
contact angle of 65 (1° and an ellipsometric thickness of 1.4
( 0.1 nm indicated the self-assembly of compound 1 on silicon.
To test the ability of surface-bound phthalimides to photo-
chemically immobilize sugars, 2000 kDa fluorescein isothio-
cyanate (FITC)-conjugated R(1,6)dextran polysaccharide films
were spin-coated onto SAM 1 from an aqueous solution and
irradiated for approximately 1 h with a 300 nm rayonet bulb in
an inert environment. Two controls were also prepared. In the
first, polysaccharides were spin-coated onto SAM 1 and left in
the dark. In the second, polysaccharides were spin-coated onto
an underivatized silicon wafer. All three samples were placed
in water-filled vials for 12 h. After removing the samples and
(22) Blawas, A. S.; Reichert, W. M. Biomaterials 1998, 19 (7-9), 595-609.
(23) Whitesides, G. M.; Ostuni, E.; Takayama, S.; Jiang, X.; Ingber, D. E.
Annu. ReV. Biomed. Eng. 2001, 3, 335-373.
(24) Pirrung, M. C. Angew. Chem., Int. Ed. 2002, 41 (8), 1276-1289.
(25) Chevolot, Y.; Bucher, O.; Leonard, D.; Mathieu, H. J.; Sigrist, H.
Bioconjugate Chem. 1999, 10 (2), 169-175.
(26) Fodor, S. P. A.; Read, J. L.; Pirrung, M. C.; Stryer, L.; Lu, A. T.; Solas,
D. Science 1991, 251 (4995), 767-773.
(27) Rozsnyai, L. F.; Fodor, S. P. A.; Schultz, P. G.; Benson, D. R. Angew.
Chem. 1992, 104 (6), 801-802.
(28) Pease, A. C.; Solas, D.; Sullivan, E. J.; Cronin, M. T.; Holmes, C. P.;
Fodor, S. P. A. Proc. Natl. Acad. Sci. U.S.A. 1994, 91 (11), 5022-5026.
(29) Dillmore, W. S.; Yousaf, M. N.; Mrksich, M. Langmuir 2004, 20 (17),
7223-7231.
(30) Lee, K.; Pan, F.; Carroll, G. T.; Turro, N. J.; Koberstein, J. T. Langmuir
2004, 20 (5), 1812-1818.
(31) Kanaoka, Y. Acc. Chem. Res. 1978, 11 (11), 407-413.
(32) Wang, D. Proteomics 2003, 3 (11), 2167-2175.
(33) Turro, N. J. Modern Molecular Photochemistry; University Science
Books: Sausalito, CA, 1991.
(34) Gilbert, B. C.; King, D. M.; Thomas, C. B. Carbohydr. Res. 1984, 125
(2), 217-235.
(35) Moon, J. H.; Shin, J. W.; Kim, S. Y.; Park, J. W. Langmuir 1996, 12 (20),
4621-4624.
Figure 1. Schematic of a phthalimide derivative undergoing a photochemical hydrogen abstraction reaction followed by recombination to
form a covalent bond.
2900 Langmuir, Vol. 22, No. 6, 2006 Carroll et al.
rinsing with water and methanol followed by blow-drying with
argon, the fluorescence spectrum of each sample was obtained,
as shown in Figure 4. Preferential retention of polysaccharides
on the irradiated sample relative to the two controls indicates the
photochemical immobilization of the polysaccharides on SAM
1.
The film thicknesses of the three samples were measured using
a Beaglehole ellipsometer in variable angle mode. A refractive
index value of 1.5 was used for the organic layer. The irradiated
sample retained 7.1 ( 0.3 nm of material after the rinse. The
thickness of the material on SAM 1 unexposed to light was 0.7
( 0.3 nm, and the thickness on the underivatized silicon wafer
was 0.4 ( 0.3 nm. The reported thicknesses do not include the
thickness of SAM 1. The surfaces were further investigated with
water contact-angle measurements. The hydrophilic nature of
the sugars reduced the water contact angle from 65 ( 1 to 28
( 1° on the irradiated SAM. Inefficient immobilization on the
dark control is evident from a post-rinse contact angle of 62 (
1°. The higher retention of material on the irradiated SAM
demonstrates that self-assembled phthalimide monolayers are
capable of photochemically bonding to an overlayer sugar film,
despite any spatial restrictions on the chromophore as a result
of placement in a constrained environment. We speculate that
the nature of the bonding is covalent and results from radical-
radical recombination following hydrogen abstraction.
The above experiments were also performed on SAMs
comprised of benzophenone chromophores, another class of
aromatic carbonyls that can photochemically abstract hydrogen
from C-H groups and have been shown to graft polymers to
surfaces.36 Although the benzophenone monolayers were able to
graftthesugars,theresultingsugarfilmthicknessandfluorescence
intensity were lower, and the contact angle was higher than that
of the films on SAM 1. The lower performance may be due to
the radical center in the benzophenone SAM residing further
from the surface than that in the phthalimides, self-quenching
of the excited state, or a higher interfacial tension between the
more hydrophobic benzophenone monolayer and the sugar film
compared to the phthalimide-sugar interaction. Benzophenone
SAMs have more hydrophobic character than phthalimide SAMs,
as evidenced by a higher water contact angle of about 85°.
Preliminary experiments with a microarray spotter have shown
thathydrophilicsurfacesaremoreeasilyspottedthanhydrophobic
substrates. We found that more material physisorbed onto SAM
1 in comparison to a benzophenone-terminated SAM. In any
case, other photoactive carbonyl groups capable of abstracting
hydrogen atoms can be substituted and may enhance or retard
the reaction because of the efficiency of self-assembly, steric,
and thermodynamic constraints.
In addition to covalently attaching underivatized sugars to a
substrate, we are also able to generate patterns of grafted sugars.
Our strategy for immobilizing carbohydrates on SAM 1 in a
spatially controlled fashion is presented in Figure 5. Spin-coated
polysaccharide films were covered with a photomask consisting
of a copper grid with spacings of 280 µm and irradiated for 2
h as described above. The photoreaction is restricted to the opaque
regions of the mask, leaving the pattern of the mask written to
the surface via attached carbohydrates. We removed ungrafted
sugars by sonicating films in water for 15 min, changing the
water and vial every 5 min.
(36) Prucker, O.; Naumann, C. A.; Ruehe, J.; Knoll, W.; Frank, C. W. J. Am.
Chem. Soc. 1999, 121 (38), 8766-8770.
Figure 2. Synthesis of compound 1 and SAM 1.
Figure 3. UV/vis spectra of compound 1 in ethanol (dashed line)
and SAM 1 (solid line).
Figure 4. Fluorescence spectra of 2000 kDa FITC-conjugated R-
(1,6)dextran films under three conditions: irradiated SAM 1 (dashed
line), dark SAM 1 (dotted line), and underivatized silicon (solid
line). Each spectrum was obtained after washing the substrates for
12 h in H2O.
Photochemical Micropatterning of Carbohydrates Langmuir, Vol. 22, No. 6, 2006 2901
Condensing water onto the substrate provided a quick way to
visualize the hydrophilic patterns using optical microscopy.37
Figure 6 presents an optical microscope image of water
condensation onto patterned R(1,6)dextran polysaccharides with
a MW of 2000 kDa. The hydrophilic attraction between water
andthepolysaccharidesrelativetotheunmodifiedmaskedregions
of the monolayer causes water to preferentially reside on the
areas of the substrate containing polysaccharide. The results were
similar when 20 kDa R(1,6)dextrans were patterned.
Other strategies involving immobilization without prior
derivatization have been successful with carbohydrate-containing
macromolecules noncovalently adsorbed on nitrocellulose1 or
oxidized polystyrene (PS);5 however, the nitrocellulose study
showed that the immobilization efficiency decreases with the
MW of the polysaccharides.1 To show the versatility of our
method, we tested glucose and sucrosestwo simple sugars at the
low extreme of MW, containing both six- and five-membered
sugar moieties. The resulting water condensation images are
presented in Figure 7. The visible patterns clearly show that our
method extends to sugars of the lowest MWs.
To show that our method is applicable for the high-throughput
production of carbohydrate microarrays, we investigated whether
carbohydrates could be microspotted and subsequently photo-
immobilized using a robotic spotter. We applied the FITC-
conjugated polysaccharides as probes to monitor the spotting
(37) Lopez, G. P.; Biebuyck, H. A.; Frisbie, C. D.; Whitesides, G. M. Science
1993, 260 (5108), 647-649.
Figure 5. The strategy for direct chemical patterning of a surface with carbohydrates involves a photolithographic technique. Carbohydrates
are spin-coated onto SAM 1 and covered with a mask. Irradiation induces a photochemical reaction that covalently links the carbohydrates
to SAM 1.
Figure 6. Optical microscope images of water condensation on
photochemically generated patterns of polysaccharides on SAM 1.
Figure 7. Optical microscope images of breath condensation on
photochemically generated patterns of (a) sucrose and (b) glucose.
2902 Langmuir, Vol. 22, No. 6, 2006 Carroll et al.
process. After irradiation for 1 h, extensive washing, and
“blocking” with bovine serum albumin (BSA), we introduced
specific antibodies and lectins to detect immobilized carbohy-
drates. Bound antibodies were revealed with a streptavidin-Cy3
conjugate. We found that the thermodynamic parameters of the
surface needed to be adjusted to transfer a detectable amount of
carbohydrates from the pin of the spotter to SAM 1. To make
the surface more attractive to carbohydrates, we made mixed
phthalimide-amine monolayers (PAM) from a solution contain-
ing a 5:1 ratio of aminopropyltrimethoxy silane to compound 1.
Presumably,thehydrophilicaminegroupinteractsmorefavorably
with the carbohydrates compared to the more hydrophobic phenyl
ring of compound 1, decreasing the interfacial tension between
the carbohydrate and the substrate, which allows a sufficient
amount of carbohydrates to be adsorbed to the surface for
subsequent photoimmobilization.
Figure 8a,b presents the results after spotting FITC-conjugated
R(1,6)dextrans with MWs of 20, 70, and 2000 kDa on PAM and
nitrocellulose-coated FAST slides. The FAST slide was treated
to provide a comparison of our new method with an established
platform. By examining the fluorescent signals of the spotted
slides before irradiation and washing (Figure 8a), we found that
theamountsofcarbohydratesadsorbedontoPAMaresignificantly
less than those spotted on the FAST slide. This may be attributed
to the two-dimensional nature of PAM, which allows less
polysaccharides to be delivered and adsorbed in comparison to
nitrocellulose surfaces with thicker three-dimensional coatings.
However, staining the slides with an anti-R(1,6)dextran antibody
(16.4.12E), which is specific for the terminal nonreducing end
epitopes displayed by all three dextran conjugates1 revealed that
the PAM surface retains a similar amount of polysaccharides
regardless of the MW of the polysaccharides spotted (Figure
8b). Neither an underivatized glass substrate nor PAM without
UVirradiationshowedadetectablesignalwithanti-R(1,6)dextran
antibodies under the same experimental conditions. These results
were reproduced in multiple microarray assays (data not shown).
Thus, not only is PAM suitable for use in the high-throughput
construction of polysaccharide microarrays, but the photoim-
mobilized carbohydrates also retain their immunological proper-
ties, as defined by a specific antibody, after immobilization.
We further examined a panel of mono- and oligosaccharide
arrays on PAM and FAST slides. The spotted arrays were probed
with a biotinylated lectin, Concanavalin A (Con A; Figure 8c),
which is Man- and/or Glc-specific and requires the C-3, C-4, and
C-5 hydroxyl groups of the Man or Glc ring for binding. We
found that oligosaccharides with three (IM3), five (IM5), and
seven glucoses (IM7) are reactive to Con A on the PAM slide
but not on the FAST slide. However, none of the spotted
monosaccharides were reactive to the lectin on these surfaces.
The method of photocoupling, which can target any CH- group
on the sugar rings with varying specificity depending on the
structure of the ring34,38,39 (Figure 5), may interfere significantly
with the lectin binding of monosaccharides, Man, or Glc. The
limited specificity of the reaction and the lesser amount of
saccharide epitopes present for smaller carbohydrates reduces
(38) Madden, K. P.; Fessenden, R. W. J. Am. Chem. Soc. 1982, 104 (9), 2578-
2581.
(39) Shkrob, I. A.; Depew, M. C.; Wan, J. K. S. Chem. Phys. Lett. 1993, 202
(1-2), 133-140.
Figure 8. Immobilization of mono-, oligo-, and polysaccharides on PAM. A FAST slide is included for comparison. (A) Fluorescence images
and intensity values of the spotted polysaccharides, the FITC-conjugated R(1,6)dextrans of 20-, 70-, and 2000 kD, before treatment with
light. The three-dimensional FAST slide adsorbs more material than does the two-dimensional PAM. (B) Fluorescence images and intensity
values after treatment with light, rinsing, and staining with a biotinylated anti-dextran antibody (16.4.12E), followed by staining with a
Streptavidin-Cy3 conjugate. Immobilization on PAM is not dependent on MW, and a greater amount of 20 kD polysaccharides are retained
even though much less material could initially be spotted. (C) Fluorescence intensity values of mono- and oligosaccharide arrays after
treatment with light, rinsing, and staining with a biotinylated lectin, Con A, followed by staining with a Streptavidin-Cy5 conjugate. IM3,
IM5, and IM7 refer to isomaltotriose, isomaltopentose, and isomaltoheptaose, respectively.
Photochemical Micropatterning of Carbohydrates Langmuir, Vol. 22, No. 6, 2006 2903
the probability that a biologically active epitope presents itself
at the air-monolayer interface.
These results show that PAM offers a plausible alternative to
nitrocellulosefordisplayingpolysaccharidesandoligosaccharides
on glass chips. Larger panels of carbohydrates with structural
and immunological diversities must be introduced to further
validate and explore the potential of this novel chip substrate for
microarray technologies.
Althoughthisreportfocusesontheapplicationofimmobilizing
andpatterningcarbohydrates,phthalimide-containingmonolayers
are suitable for patterning virtually any material containing C-H
groups. In addition to various carbohydrates, we are also able
to pattern a variety of polymers. PS, poly(methyl methacrylate)
(PMMA), and poly(vinyl alcohol) (PVA) were all immobilized
and patterned on SAM 1 (see Supporting Information for images).
Theversatilityofourmethodallowsmaterialswithvaryingsurface
tensions and chemical functionalities to be immobilized and
patterned on a surface, allowing for a fast and simple approach
to design organic scaffolds for novel materials and devices.
Summary
We have shown that a new class of SAMs containing
phthalimide chromophores is capable of photochemically im-
mobilizing carbohydrates on a flat substrate. The method requires
no chemical modification of the carbohydrates prior to deposition
and is not limited to carbohydrates of high MWs. Further,
immobilizedcarbohydrateantigensareshowntoretaintheirability
to interact with the corresponding antibody or lectin. The
photochemicalnatureofthetechniqueallowspatternstobecreated
and makes the method adaptable to the full potential of
photolithography, which is currently used in industry for the
high-throughput fabrication of computer chips and nanoscale
patterning. Multiple carbohydrate patterns can be immobilized
by repeating the reaction with a different carbohydrate in a
previously masked region. In conjunction with a microarray
spotter, large libraries of carbohydrates can be immobilized on
our surface without previous derivatization. The versatility and
ease of the method provides a platform for biologists, chemists,
and engineers to investigate and create new biological materials
aswellascharacterizecarbohydrateinteractionsinarapidmanner.
Methods
Synthesis of Compound 1. A 3.3 mmol portion of 11-
bromoundecanetrimethoxysilane (Gelest) was added to a solution
of an equimolar amount of potassium phthalimide (Aldrich) in 60
mL of anhydrous DMF (Aldrich). The solution was stirred overnight
at room temperature (RT) under argon. Chloroform (50 mL) was
added. The solution was transferred to a separatory flask containing
50 mL of H2O. The aqueous layer was separated and then extracted
with two 20 mL portions of chloroform. The combined chloroform
extract was washed with several 20 mL portions of H2O. The
chloroform was removed by rotoevaporation, and residual DMF
was removed on a high vacuum line to give a pale yellow liquid
(0.99 g, 72% yield). The compound was used without further
purification. Note that, for self-assembly experiments, residual DMF
was not removed. 1H NMR: (CDCl3) δ 7.82 (m, 2H), 7.69 (m, 2H),
3.66 (t, J ) 7 Hz, 2H), 3.55 (s, 9H), 1.44-1.15 (m, 18H), 0.71-0.51
(m, 2H). LRMS-FAB+ (m/z): (M - H) 420.2 (experimental), 420.2
(calculated); (M - OCH3) 390.1 (experimental), 390.2 (calculated).
Self-Assembly of SAM 1. The substrates consisted of glass
(ArrayIt), quartz (SPI), or silicon (wafer world). The substrates and
glassware were cleaned by being boiled in a “piranha” solution (7:3
sulfuric acid/H2O2) for 1 h followed by an extensive rinse with water
and methanol. Substrates were dried with a stream of argon and
immersed in a 1 mmol solution of compound 1 in anhydrous toluene
(Aldrich). The solution was kept under argon and left undisturbed
for 12 h. The resulting SAMs were rinsed with toluene and sonicated
three times for 2 min each in toluene, toluene/methanol (1:1), and
methanol. Substrates were kept in argon-purged vials until further
use.
Preparation of PAM. PAM was made in the same manner as
SAM 1, except that a 5× molar amount of aminopropyltrimethoxy
silane (Gelest) was simultaneously added with compound 1. The
contact angle of the resulting surface was 72 ( 1°.
Photochemical Grafting of Polysaccharide Films. FITC-
conjugated R(1,6)dextrans weighing 20 or 2000 kD (Dextran-FITC)
(Sigma) were spin-coated from a 10 mg/mL aqueous solution at
3000rpmfor90sandplacedinargon-purgedquartztubes.Irradiation
was carried out for 70 min with a Rayonet photochemical reactor
equipped with lamps that emit at 300 nm. For ellipsometry and
fluorescence experiments, the surface was rinsed by placing in H2O
for 12 h followed by rinsing with methanol. Substrates were blown
dry with argon.
Instrumental Measurements. UV-vis spectra were obtained
using a Shimadzu (UV-2401PC) UV-vis recording spectropho-
tometer. Contact-angle measurements were performed with a Rame-
Hart 100-00 contact-angle goniometer using Millipore Milli-Q water.
At least three droplets were measured on each sample and averaged.
ThicknessesweremeasuredwithaBeagleholeellipsometerinvariable
angle mode. A refractive index of 1.5 was used for all samples.
Measurements were performed three times in different locations on
the surface and averaged. Fluorescence spectra were obtained using
a Jobin Yvon Fluorolog 3 spectrofluorometer in front face mode.
The surface was placed at an angle of 20° to a line parallel to the
plane of the detector.
Photochemical Patterning of Carbohydrates. A 75-mesh
transmission electron microscopy (TEM) grid (Electron Microscopy)
was used as a photomask for all patterning experiments. Dextran-
FITC (2000 kD) and 20 kD polysaccharide films were prepared as
described above. Glucose (Aldrich) was spin-coated from a solution
of 26 mg in 1 mL of acetonitrile at 3000 rpm for 90 s. One drop
of a sucrose (Aldrich) solution containing 1.5 g in 1 mL H2O was
placed on the substrate using a pipet. Approximately three-fourths
of the drop was removed with a pipet. In all cases, the photomask
was placed on top of the sugar film or droplet and pressed down with
a quartz plate. Irradiation was carried out in an argon-filled glovebag
with a desktop lamp containing a 300 nm Rayonet bulb for
approximately 2 h. Samples were rinsed by sonication in H2O for
15min,withthewaterandvialbeingchangedevery5min.Sonication
was accompanied by extensive rinsing with water and methanol.
Samples were blown dry with argon.
Visualization of the Chemically Patterned Surface. Patterns
were visualized by condensing water onto the pattern and imaging
with a Nikon Eclipse optical microscope equipped with an INSIGHT
digital camera. Two methods were used to condense water onto the
surface. In the first, the surface was exposed to an extended breath.
In the second, the substrate was held over boiling water for
approximately 10 s.
Microarray Construction. Antigen preparations were dissolved
in saline (0.9% NaCl) at a given concentration and were spotted as
triplet replicate spots in parallel. The initial amount of antigen spotted
was approximately 0.35 ng/spot and was diluted by serial dilutions
of 1:5 thereafter (see also the microarray images inserted in Figure
8). A high-precision robot designed to produce cDNA microarrays
(PIXSYS 5500C, Cartesian Technologies, Irvine, CA) was utilized
to spot carbohydrate antigens onto chemically modified glass slides
as described.1,6 Both FAST slides (Schleicher & Schuell, Keene,
NH) and PAM slides were spotted. The printed FAST slides were
air-dried and stored at RT. The printed PAM slides were subjected
to UV irradiation to activate the photocoupling of carbohydrates to
the surface.
PhotocouplingofCarbohydratesontheChips.Aftermicroarray
spotting, the PAM slides were air-dried and placed in a quartz tube.
The sealed tube was subsequently purged with argon or nitrogen
before irradiation. UV irradiation was conducted by placing the
quartz tube under a desktop lamp containing a 300 nm Rayonet bulb
2904 Langmuir, Vol. 22, No. 6, 2006 Carroll et al.
for 1 h. Precaution was made to avoid skin and eye contact with the
radiation during the irradiation process.
Microarray Staining, Scanning, and Data-Processing. Im-
mediately beforeuse,theprintedmicroarrayswererinsedandwashed
withphosphate-bufferedsaline(PBS)(pH7.4)andwith0.05%Tween
20 five times, with 5 min of incubation in each washing step. They
were then “blocked” by incubating the slides in 1% BSA in PBS
containing 0.05% NaN3 at RT for 30 min. Antibody staining was
conducted at RT for 1 h at given dilutions in 1% BSA/PBS containing
0.05% NaN3 and 0.05% Tween 20. Since a biotinylated anti-dextran
antibody (mAb 16. 4.12E, adapted from the late Professor Elvin A.
Kabat at Columbia University) and lectin Con A (EY Laboratories,
San Mateo, CA) were applied in this study, streptavidin-Cy3
conjugateorstreptavidin-Cy5conjugate(AmershamPharmasia)were
applied to reveal the bound anti-dextran antibodies or lectin Con A,
respectively. The stained slides were rinsed five times with PBS and
with 0.05% Tween 20 after each staining step. A ScanArray 5000A
standard biochip scanning system (Perkin Elmer, Torrance, CA),
equipped with multiple lasers, emission filters, and ScanArray
acquisition software, was used to scan the microarray. Fluorescence
intensityvaluesforeacharrayspotanditsbackgroundwerecalculated
using ScanArray Express (Perkin Elmer, Torrance, CA).
Acknowledgment. This material is based upon work sup-
ported by, or in part by, the U.S. Army Research Laboratory and
the U.S. Army Research Office under Contract/Grant No. DA
W911NF-04-1-0282, the National Science Foundation under
Grant Nos. DMR-02-14263, IGERT-02-21589, and CHE-04-
15516 to N.J.T. and J.T.K. at Columbia University, and the Phil
N. Allen Trust and the Herzenberg Trust to D.W. at Stanford
University. This work used the shared experimental facilities
that are supported primarily by the MRSEC Program of the
National Science Foundation under Award No. DMR-0213574
and the New York State Office of Science, Technology and
AcademicResearch(NYSTAR).G.T.C.acknowledgesanIGERT
fellowship. Any opinions, findings, and conclusions or recom-
mendations expressed in this material are those of the author(s)
and do not necessarily reflect the views of the National Science
Foundation.
SupportingInformationAvailable: Optical microscope images
of patterns of PVA, poly(tert-butyl acrylate) (PTBA), and PS. This
material is available free of charge via the Internet at http://pubs.acs.org.
LA0531042
Photochemical Micropatterning of Carbohydrates Langmuir, Vol. 22, No. 6, 2006 2905

Más contenido relacionado

La actualidad más candente

Application of Nanomaterials in Medicine: Drug delivery, Diagnostics and Ther...
Application of Nanomaterials in Medicine: Drug delivery, Diagnostics and Ther...Application of Nanomaterials in Medicine: Drug delivery, Diagnostics and Ther...
Application of Nanomaterials in Medicine: Drug delivery, Diagnostics and Ther...Premier Publishers
 
Ameliorative Potentials of a Combination of Fenugreek and α-tocopherol on Cad...
Ameliorative Potentials of a Combination of Fenugreek and α-tocopherol on Cad...Ameliorative Potentials of a Combination of Fenugreek and α-tocopherol on Cad...
Ameliorative Potentials of a Combination of Fenugreek and α-tocopherol on Cad...Prof. Hesham N. Mustafa
 
Biochemistry (mathews 3rd ed)
Biochemistry (mathews 3rd ed)Biochemistry (mathews 3rd ed)
Biochemistry (mathews 3rd ed)Loreto Puig
 
Bacterial magnetosomes. microbiology, biomineralization and biotechnological ...
Bacterial magnetosomes. microbiology, biomineralization and biotechnological ...Bacterial magnetosomes. microbiology, biomineralization and biotechnological ...
Bacterial magnetosomes. microbiology, biomineralization and biotechnological ...CAS0609
 
Bsc ii iv-vi sem imb
Bsc ii iv-vi sem imbBsc ii iv-vi sem imb
Bsc ii iv-vi sem imbdrasuaa
 
Toxicity of Silica Nano particles
Toxicity of Silica Nano particlesToxicity of Silica Nano particles
Toxicity of Silica Nano particlesHina Maqsood
 
4 16s rna partial sequencing of isolated strains of metal resistant bacteria ...
4 16s rna partial sequencing of isolated strains of metal resistant bacteria ...4 16s rna partial sequencing of isolated strains of metal resistant bacteria ...
4 16s rna partial sequencing of isolated strains of metal resistant bacteria ...BIOLOGICAL FORUM
 
Biomaterials in oral and maxillofacial surgery /oral surgery courses by ...
Biomaterials  in oral  and  maxillofacial  surgery  /oral surgery courses by ...Biomaterials  in oral  and  maxillofacial  surgery  /oral surgery courses by ...
Biomaterials in oral and maxillofacial surgery /oral surgery courses by ...Indian dental academy
 
Christian Mueller ABIO 399 paper 12 16 15
Christian Mueller ABIO 399 paper 12 16 15Christian Mueller ABIO 399 paper 12 16 15
Christian Mueller ABIO 399 paper 12 16 15Christian Mueller
 
EGRupdatedCVwithCL052015
EGRupdatedCVwithCL052015EGRupdatedCVwithCL052015
EGRupdatedCVwithCL052015Erik Rogers
 
Mohamed kamal saleh_c_v (update oct 2011)
Mohamed kamal saleh_c_v (update oct 2011)Mohamed kamal saleh_c_v (update oct 2011)
Mohamed kamal saleh_c_v (update oct 2011)Mohamed Kamal Saleh
 
Biochemistry.4th.edition
Biochemistry.4th.editionBiochemistry.4th.edition
Biochemistry.4th.editionRione Drevale
 
Magnetosome | Magnetotactic bacteria (MTB) |
Magnetosome | Magnetotactic bacteria (MTB) | Magnetosome | Magnetotactic bacteria (MTB) |
Magnetosome | Magnetotactic bacteria (MTB) | Bishnu Pattnaik
 
Ijms 15-07639 solucion-celulascancer
Ijms 15-07639 solucion-celulascancerIjms 15-07639 solucion-celulascancer
Ijms 15-07639 solucion-celulascancerakire_aicrag22
 
boe-6-10-4098
boe-6-10-4098boe-6-10-4098
boe-6-10-4098Gen Vigil
 
Cytogenetic effects of benzene on human blood cells
Cytogenetic effects of benzene on human blood cellsCytogenetic effects of benzene on human blood cells
Cytogenetic effects of benzene on human blood cellsAlexander Decker
 
Accelero bio founderswork_031717
Accelero bio founderswork_031717Accelero bio founderswork_031717
Accelero bio founderswork_031717Debanu Das
 

La actualidad más candente (20)

Application of Nanomaterials in Medicine: Drug delivery, Diagnostics and Ther...
Application of Nanomaterials in Medicine: Drug delivery, Diagnostics and Ther...Application of Nanomaterials in Medicine: Drug delivery, Diagnostics and Ther...
Application of Nanomaterials in Medicine: Drug delivery, Diagnostics and Ther...
 
Ameliorative Potentials of a Combination of Fenugreek and α-tocopherol on Cad...
Ameliorative Potentials of a Combination of Fenugreek and α-tocopherol on Cad...Ameliorative Potentials of a Combination of Fenugreek and α-tocopherol on Cad...
Ameliorative Potentials of a Combination of Fenugreek and α-tocopherol on Cad...
 
srep06325
srep06325srep06325
srep06325
 
Biochemistry (mathews 3rd ed)
Biochemistry (mathews 3rd ed)Biochemistry (mathews 3rd ed)
Biochemistry (mathews 3rd ed)
 
B3 sc proceedings
B3 sc proceedingsB3 sc proceedings
B3 sc proceedings
 
Bacterial magnetosomes. microbiology, biomineralization and biotechnological ...
Bacterial magnetosomes. microbiology, biomineralization and biotechnological ...Bacterial magnetosomes. microbiology, biomineralization and biotechnological ...
Bacterial magnetosomes. microbiology, biomineralization and biotechnological ...
 
Bsc ii iv-vi sem imb
Bsc ii iv-vi sem imbBsc ii iv-vi sem imb
Bsc ii iv-vi sem imb
 
Toxicity of Silica Nano particles
Toxicity of Silica Nano particlesToxicity of Silica Nano particles
Toxicity of Silica Nano particles
 
4 16s rna partial sequencing of isolated strains of metal resistant bacteria ...
4 16s rna partial sequencing of isolated strains of metal resistant bacteria ...4 16s rna partial sequencing of isolated strains of metal resistant bacteria ...
4 16s rna partial sequencing of isolated strains of metal resistant bacteria ...
 
Hndm proceedings
Hndm proceedingsHndm proceedings
Hndm proceedings
 
Biomaterials in oral and maxillofacial surgery /oral surgery courses by ...
Biomaterials  in oral  and  maxillofacial  surgery  /oral surgery courses by ...Biomaterials  in oral  and  maxillofacial  surgery  /oral surgery courses by ...
Biomaterials in oral and maxillofacial surgery /oral surgery courses by ...
 
Christian Mueller ABIO 399 paper 12 16 15
Christian Mueller ABIO 399 paper 12 16 15Christian Mueller ABIO 399 paper 12 16 15
Christian Mueller ABIO 399 paper 12 16 15
 
EGRupdatedCVwithCL052015
EGRupdatedCVwithCL052015EGRupdatedCVwithCL052015
EGRupdatedCVwithCL052015
 
Mohamed kamal saleh_c_v (update oct 2011)
Mohamed kamal saleh_c_v (update oct 2011)Mohamed kamal saleh_c_v (update oct 2011)
Mohamed kamal saleh_c_v (update oct 2011)
 
Biochemistry.4th.edition
Biochemistry.4th.editionBiochemistry.4th.edition
Biochemistry.4th.edition
 
Magnetosome | Magnetotactic bacteria (MTB) |
Magnetosome | Magnetotactic bacteria (MTB) | Magnetosome | Magnetotactic bacteria (MTB) |
Magnetosome | Magnetotactic bacteria (MTB) |
 
Ijms 15-07639 solucion-celulascancer
Ijms 15-07639 solucion-celulascancerIjms 15-07639 solucion-celulascancer
Ijms 15-07639 solucion-celulascancer
 
boe-6-10-4098
boe-6-10-4098boe-6-10-4098
boe-6-10-4098
 
Cytogenetic effects of benzene on human blood cells
Cytogenetic effects of benzene on human blood cellsCytogenetic effects of benzene on human blood cells
Cytogenetic effects of benzene on human blood cells
 
Accelero bio founderswork_031717
Accelero bio founderswork_031717Accelero bio founderswork_031717
Accelero bio founderswork_031717
 

Destacado

Análisis Urbano "Cono de Seguridad del Aeropuerto de Barquisimeto, Venezuela"
Análisis Urbano "Cono de Seguridad del Aeropuerto de Barquisimeto, Venezuela"Análisis Urbano "Cono de Seguridad del Aeropuerto de Barquisimeto, Venezuela"
Análisis Urbano "Cono de Seguridad del Aeropuerto de Barquisimeto, Venezuela"Scarlett Velasquez
 
Application optimization with POWER 7
Application optimization with POWER 7Application optimization with POWER 7
Application optimization with POWER 7COMMON Europe
 
Employee energy measurement and energy vs. engagement
Employee energy measurement and energy vs. engagement Employee energy measurement and energy vs. engagement
Employee energy measurement and energy vs. engagement The University of Alabama
 
LMC FW13 Ads Europe
LMC FW13 Ads EuropeLMC FW13 Ads Europe
LMC FW13 Ads Europesjanszen83
 
Clase1 Fundamentos de Comunicaciones Electronicas
Clase1 Fundamentos de Comunicaciones ElectronicasClase1 Fundamentos de Comunicaciones Electronicas
Clase1 Fundamentos de Comunicaciones ElectronicasJohan Silva Cueva
 
1000 1200 _stained_glass
1000 1200 _stained_glass1000 1200 _stained_glass
1000 1200 _stained_glassStefanie Pender
 
R3: Ruta Entrerrías Vilaboa-Pontevedra - bicicleando.es
R3: Ruta Entrerrías Vilaboa-Pontevedra - bicicleando.esR3: Ruta Entrerrías Vilaboa-Pontevedra - bicicleando.es
R3: Ruta Entrerrías Vilaboa-Pontevedra - bicicleando.esBicicleando
 
Jugend 2011. Polen - Berlin 2012
Jugend 2011. Polen - Berlin 2012Jugend 2011. Polen - Berlin 2012
Jugend 2011. Polen - Berlin 2012Piotr Arak
 
Diagramas de Fase, Mecanica de Materiales
Diagramas de Fase, Mecanica de MaterialesDiagramas de Fase, Mecanica de Materiales
Diagramas de Fase, Mecanica de MaterialesNoble Drilling
 
Las Generaciones En El Tiempo
Las Generaciones En El TiempoLas Generaciones En El Tiempo
Las Generaciones En El Tiempoguestfee961a
 
La Medalla Fields & Stanislav Smirnov
La Medalla Fields & Stanislav SmirnovLa Medalla Fields & Stanislav Smirnov
La Medalla Fields & Stanislav Smirnovjavierbecerrilg
 
Cuento Espectáculo "CALLES" Engrata Teatre
Cuento Espectáculo "CALLES" Engrata TeatreCuento Espectáculo "CALLES" Engrata Teatre
Cuento Espectáculo "CALLES" Engrata TeatreJose Angel Gomis
 
Collar de perlas negras definitivo
Collar de perlas negras definitivoCollar de perlas negras definitivo
Collar de perlas negras definitivoAlejandra Jara
 

Destacado (20)

Tendales de poesía
Tendales de poesíaTendales de poesía
Tendales de poesía
 
Broschuere Italienisch Sprachschule Italien 2010
Broschuere Italienisch Sprachschule Italien 2010Broschuere Italienisch Sprachschule Italien 2010
Broschuere Italienisch Sprachschule Italien 2010
 
Análisis Urbano "Cono de Seguridad del Aeropuerto de Barquisimeto, Venezuela"
Análisis Urbano "Cono de Seguridad del Aeropuerto de Barquisimeto, Venezuela"Análisis Urbano "Cono de Seguridad del Aeropuerto de Barquisimeto, Venezuela"
Análisis Urbano "Cono de Seguridad del Aeropuerto de Barquisimeto, Venezuela"
 
Application optimization with POWER 7
Application optimization with POWER 7Application optimization with POWER 7
Application optimization with POWER 7
 
Employee energy measurement and energy vs. engagement
Employee energy measurement and energy vs. engagement Employee energy measurement and energy vs. engagement
Employee energy measurement and energy vs. engagement
 
LMC FW13 Ads Europe
LMC FW13 Ads EuropeLMC FW13 Ads Europe
LMC FW13 Ads Europe
 
Clase1 Fundamentos de Comunicaciones Electronicas
Clase1 Fundamentos de Comunicaciones ElectronicasClase1 Fundamentos de Comunicaciones Electronicas
Clase1 Fundamentos de Comunicaciones Electronicas
 
Delft climate kic 070212 part 1
Delft climate kic 070212 part 1Delft climate kic 070212 part 1
Delft climate kic 070212 part 1
 
Boletin 6
Boletin 6Boletin 6
Boletin 6
 
1000 1200 _stained_glass
1000 1200 _stained_glass1000 1200 _stained_glass
1000 1200 _stained_glass
 
R3: Ruta Entrerrías Vilaboa-Pontevedra - bicicleando.es
R3: Ruta Entrerrías Vilaboa-Pontevedra - bicicleando.esR3: Ruta Entrerrías Vilaboa-Pontevedra - bicicleando.es
R3: Ruta Entrerrías Vilaboa-Pontevedra - bicicleando.es
 
Jugend 2011. Polen - Berlin 2012
Jugend 2011. Polen - Berlin 2012Jugend 2011. Polen - Berlin 2012
Jugend 2011. Polen - Berlin 2012
 
Diagramas de Fase, Mecanica de Materiales
Diagramas de Fase, Mecanica de MaterialesDiagramas de Fase, Mecanica de Materiales
Diagramas de Fase, Mecanica de Materiales
 
Las Generaciones En El Tiempo
Las Generaciones En El TiempoLas Generaciones En El Tiempo
Las Generaciones En El Tiempo
 
La Medalla Fields & Stanislav Smirnov
La Medalla Fields & Stanislav SmirnovLa Medalla Fields & Stanislav Smirnov
La Medalla Fields & Stanislav Smirnov
 
Cuento Espectáculo "CALLES" Engrata Teatre
Cuento Espectáculo "CALLES" Engrata TeatreCuento Espectáculo "CALLES" Engrata Teatre
Cuento Espectáculo "CALLES" Engrata Teatre
 
Lenguaje musical
Lenguaje musicalLenguaje musical
Lenguaje musical
 
Transbeneficios
TransbeneficiosTransbeneficios
Transbeneficios
 
criteris
criteris criteris
criteris
 
Collar de perlas negras definitivo
Collar de perlas negras definitivoCollar de perlas negras definitivo
Collar de perlas negras definitivo
 

Similar a Photochemical Micropatterning of Carbohydrates on a Surface

Diazonium Protein... Corgier Et Al.
Diazonium Protein...   Corgier Et Al.Diazonium Protein...   Corgier Et Al.
Diazonium Protein... Corgier Et Al.christophemarquette
 
Radiolytic Modification of Basic Amino Acid Residues in Peptides : Probes for...
Radiolytic Modification of Basic Amino Acid Residues in Peptides : Probes for...Radiolytic Modification of Basic Amino Acid Residues in Peptides : Probes for...
Radiolytic Modification of Basic Amino Acid Residues in Peptides : Probes for...Keiji Takamoto
 
Straightfoward Protein Immobilization...
Straightfoward Protein Immobilization...Straightfoward Protein Immobilization...
Straightfoward Protein Immobilization...christophemarquette
 
Poster session abs new trends 2015
Poster session abs new trends 2015Poster session abs new trends 2015
Poster session abs new trends 2015xrqtchemistry
 
The interaction of QDs with RAW264.7 cells_ nanoparticle quantification, upta...
The interaction of QDs with RAW264.7 cells_ nanoparticle quantification, upta...The interaction of QDs with RAW264.7 cells_ nanoparticle quantification, upta...
The interaction of QDs with RAW264.7 cells_ nanoparticle quantification, upta...Olga Gladkovskaya
 
Nanobiotechnology in medical diagnostics
Nanobiotechnology in medical diagnosticsNanobiotechnology in medical diagnostics
Nanobiotechnology in medical diagnosticsMelodie Benford
 
Surface characterization and osteoblast like cells culture on collagen modifi...
Surface characterization and osteoblast like cells culture on collagen modifi...Surface characterization and osteoblast like cells culture on collagen modifi...
Surface characterization and osteoblast like cells culture on collagen modifi...Grupo de Pesquisa em Nanoneurobiofisica
 
CYP121 Drug Discovery (M. tuberculosis)
CYP121 Drug Discovery (M. tuberculosis)CYP121 Drug Discovery (M. tuberculosis)
CYP121 Drug Discovery (M. tuberculosis)Anthony Coyne
 
Carbohydrates as Nanoparticles.pdf
Carbohydrates as Nanoparticles.pdfCarbohydrates as Nanoparticles.pdf
Carbohydrates as Nanoparticles.pdfShwetaYadav990431
 
1-s2.0-S0021979716300212-main
1-s2.0-S0021979716300212-main1-s2.0-S0021979716300212-main
1-s2.0-S0021979716300212-mainSalman Malik
 
Role of Free Radicals in Etiopathology of Neurodegenerative Disorders and Rec...
Role of Free Radicals in Etiopathology of Neurodegenerative Disorders and Rec...Role of Free Radicals in Etiopathology of Neurodegenerative Disorders and Rec...
Role of Free Radicals in Etiopathology of Neurodegenerative Disorders and Rec...Pooja Shimpi
 
Multi-molecular views of a stellar nursery
Multi-molecular views of a stellar nurseryMulti-molecular views of a stellar nursery
Multi-molecular views of a stellar nurserySérgio Sacani
 
Rastogi_publication01_Biomacromolecules
Rastogi_publication01_BiomacromoleculesRastogi_publication01_Biomacromolecules
Rastogi_publication01_BiomacromoleculesAbhinav Rastogi
 
JBO_20_6_066001 (1)
JBO_20_6_066001 (1)JBO_20_6_066001 (1)
JBO_20_6_066001 (1)Gen Vigil
 
Photoactive Additives for Crosslinking Thin Polymer Films: Inhibition of Dewe...
Photoactive Additives for Crosslinking Thin Polymer Films: Inhibition of Dewe...Photoactive Additives for Crosslinking Thin Polymer Films: Inhibition of Dewe...
Photoactive Additives for Crosslinking Thin Polymer Films: Inhibition of Dewe...Gregory Carroll
 
Bacteria identification Biosensor
Bacteria identification BiosensorBacteria identification Biosensor
Bacteria identification BiosensorOscar1Miranda2
 
Bacteria identification Biosensor
Bacteria identification BiosensorBacteria identification Biosensor
Bacteria identification BiosensorOscar1Miranda2
 

Similar a Photochemical Micropatterning of Carbohydrates on a Surface (20)

Diazonium Protein... Corgier Et Al.
Diazonium Protein...   Corgier Et Al.Diazonium Protein...   Corgier Et Al.
Diazonium Protein... Corgier Et Al.
 
Radiolytic Modification of Basic Amino Acid Residues in Peptides : Probes for...
Radiolytic Modification of Basic Amino Acid Residues in Peptides : Probes for...Radiolytic Modification of Basic Amino Acid Residues in Peptides : Probes for...
Radiolytic Modification of Basic Amino Acid Residues in Peptides : Probes for...
 
Straightfoward Protein Immobilization...
Straightfoward Protein Immobilization...Straightfoward Protein Immobilization...
Straightfoward Protein Immobilization...
 
Poster session abs new trends 2015
Poster session abs new trends 2015Poster session abs new trends 2015
Poster session abs new trends 2015
 
The interaction of QDs with RAW264.7 cells_ nanoparticle quantification, upta...
The interaction of QDs with RAW264.7 cells_ nanoparticle quantification, upta...The interaction of QDs with RAW264.7 cells_ nanoparticle quantification, upta...
The interaction of QDs with RAW264.7 cells_ nanoparticle quantification, upta...
 
Nanobiotechnology in medical diagnostics
Nanobiotechnology in medical diagnosticsNanobiotechnology in medical diagnostics
Nanobiotechnology in medical diagnostics
 
Walton-2015-Nature
Walton-2015-NatureWalton-2015-Nature
Walton-2015-Nature
 
Surface characterization and osteoblast like cells culture on collagen modifi...
Surface characterization and osteoblast like cells culture on collagen modifi...Surface characterization and osteoblast like cells culture on collagen modifi...
Surface characterization and osteoblast like cells culture on collagen modifi...
 
CYP121 Drug Discovery (M. tuberculosis)
CYP121 Drug Discovery (M. tuberculosis)CYP121 Drug Discovery (M. tuberculosis)
CYP121 Drug Discovery (M. tuberculosis)
 
Carbohydrates as Nanoparticles.pdf
Carbohydrates as Nanoparticles.pdfCarbohydrates as Nanoparticles.pdf
Carbohydrates as Nanoparticles.pdf
 
1-s2.0-S0021979716300212-main
1-s2.0-S0021979716300212-main1-s2.0-S0021979716300212-main
1-s2.0-S0021979716300212-main
 
2013 APCBEES MALAYSIA CONFERENCES
2013 APCBEES MALAYSIA CONFERENCES2013 APCBEES MALAYSIA CONFERENCES
2013 APCBEES MALAYSIA CONFERENCES
 
Role of Free Radicals in Etiopathology of Neurodegenerative Disorders and Rec...
Role of Free Radicals in Etiopathology of Neurodegenerative Disorders and Rec...Role of Free Radicals in Etiopathology of Neurodegenerative Disorders and Rec...
Role of Free Radicals in Etiopathology of Neurodegenerative Disorders and Rec...
 
Multi-molecular views of a stellar nursery
Multi-molecular views of a stellar nurseryMulti-molecular views of a stellar nursery
Multi-molecular views of a stellar nursery
 
Rastogi_publication01_Biomacromolecules
Rastogi_publication01_BiomacromoleculesRastogi_publication01_Biomacromolecules
Rastogi_publication01_Biomacromolecules
 
December Highlights
December HighlightsDecember Highlights
December Highlights
 
JBO_20_6_066001 (1)
JBO_20_6_066001 (1)JBO_20_6_066001 (1)
JBO_20_6_066001 (1)
 
Photoactive Additives for Crosslinking Thin Polymer Films: Inhibition of Dewe...
Photoactive Additives for Crosslinking Thin Polymer Films: Inhibition of Dewe...Photoactive Additives for Crosslinking Thin Polymer Films: Inhibition of Dewe...
Photoactive Additives for Crosslinking Thin Polymer Films: Inhibition of Dewe...
 
Bacteria identification Biosensor
Bacteria identification BiosensorBacteria identification Biosensor
Bacteria identification Biosensor
 
Bacteria identification Biosensor
Bacteria identification BiosensorBacteria identification Biosensor
Bacteria identification Biosensor
 

Último

Handwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed textsHandwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed textsMaria Levchenko
 
Tech Trends Report 2024 Future Today Institute.pdf
Tech Trends Report 2024 Future Today Institute.pdfTech Trends Report 2024 Future Today Institute.pdf
Tech Trends Report 2024 Future Today Institute.pdfhans926745
 
2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...Martijn de Jong
 
Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024The Digital Insurer
 
The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024Rafal Los
 
Apidays New York 2024 - The value of a flexible API Management solution for O...
Apidays New York 2024 - The value of a flexible API Management solution for O...Apidays New York 2024 - The value of a flexible API Management solution for O...
Apidays New York 2024 - The value of a flexible API Management solution for O...apidays
 
HTML Injection Attacks: Impact and Mitigation Strategies
HTML Injection Attacks: Impact and Mitigation StrategiesHTML Injection Attacks: Impact and Mitigation Strategies
HTML Injection Attacks: Impact and Mitigation StrategiesBoston Institute of Analytics
 
Scaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organizationScaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organizationRadu Cotescu
 
Partners Life - Insurer Innovation Award 2024
Partners Life - Insurer Innovation Award 2024Partners Life - Insurer Innovation Award 2024
Partners Life - Insurer Innovation Award 2024The Digital Insurer
 
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...Neo4j
 
Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024The Digital Insurer
 
Powerful Google developer tools for immediate impact! (2023-24 C)
Powerful Google developer tools for immediate impact! (2023-24 C)Powerful Google developer tools for immediate impact! (2023-24 C)
Powerful Google developer tools for immediate impact! (2023-24 C)wesley chun
 
Advantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your BusinessAdvantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your BusinessPixlogix Infotech
 
[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdf[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdfhans926745
 
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptxHampshireHUG
 
Developing An App To Navigate The Roads of Brazil
Developing An App To Navigate The Roads of BrazilDeveloping An App To Navigate The Roads of Brazil
Developing An App To Navigate The Roads of BrazilV3cube
 
GenAI Risks & Security Meetup 01052024.pdf
GenAI Risks & Security Meetup 01052024.pdfGenAI Risks & Security Meetup 01052024.pdf
GenAI Risks & Security Meetup 01052024.pdflior mazor
 
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Miguel Araújo
 
Real Time Object Detection Using Open CV
Real Time Object Detection Using Open CVReal Time Object Detection Using Open CV
Real Time Object Detection Using Open CVKhem
 

Último (20)

Handwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed textsHandwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed texts
 
Tech Trends Report 2024 Future Today Institute.pdf
Tech Trends Report 2024 Future Today Institute.pdfTech Trends Report 2024 Future Today Institute.pdf
Tech Trends Report 2024 Future Today Institute.pdf
 
2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...
 
Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024
 
The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024
 
Apidays New York 2024 - The value of a flexible API Management solution for O...
Apidays New York 2024 - The value of a flexible API Management solution for O...Apidays New York 2024 - The value of a flexible API Management solution for O...
Apidays New York 2024 - The value of a flexible API Management solution for O...
 
HTML Injection Attacks: Impact and Mitigation Strategies
HTML Injection Attacks: Impact and Mitigation StrategiesHTML Injection Attacks: Impact and Mitigation Strategies
HTML Injection Attacks: Impact and Mitigation Strategies
 
Scaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organizationScaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organization
 
Partners Life - Insurer Innovation Award 2024
Partners Life - Insurer Innovation Award 2024Partners Life - Insurer Innovation Award 2024
Partners Life - Insurer Innovation Award 2024
 
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
 
Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024
 
Powerful Google developer tools for immediate impact! (2023-24 C)
Powerful Google developer tools for immediate impact! (2023-24 C)Powerful Google developer tools for immediate impact! (2023-24 C)
Powerful Google developer tools for immediate impact! (2023-24 C)
 
Advantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your BusinessAdvantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your Business
 
[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdf[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdf
 
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
 
Developing An App To Navigate The Roads of Brazil
Developing An App To Navigate The Roads of BrazilDeveloping An App To Navigate The Roads of Brazil
Developing An App To Navigate The Roads of Brazil
 
GenAI Risks & Security Meetup 01052024.pdf
GenAI Risks & Security Meetup 01052024.pdfGenAI Risks & Security Meetup 01052024.pdf
GenAI Risks & Security Meetup 01052024.pdf
 
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
 
Real Time Object Detection Using Open CV
Real Time Object Detection Using Open CVReal Time Object Detection Using Open CV
Real Time Object Detection Using Open CV
 
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
 

Photochemical Micropatterning of Carbohydrates on a Surface

  • 1. Photochemical Micropatterning of Carbohydrates on a Surface Gregory T. Carroll,† Denong Wang,‡ Nicholas J. Turro,†,§ and Jeffrey T. Koberstein*,§ Department of Chemistry, Columbia UniVersity, 3000 Broadway, MC 3157, 10027, New York, New York, Carbohydrate Microarray Laboratory, Departments of Genetics, Neurology, and Neurological Sciences, Stanford UniVersity School of Medicine, Beckman Center B007, 94305, Stanford, California, and Department of Chemical Engineering, Columbia UniVersity, 500 West 120th Street, 10027, New York, New York 10027 ReceiVed NoVember 16, 2005. In Final Form: January 9, 2006 In this report, we demonstrate a versatile method for the immobilization and patterning of unmodified carbohydrates onto glass substrates. The method employs a novel self-assembled monolayer to present photoactive phthalimide chromophores at the air-monolayer interface. Upon exposure to UV radiation, the phthalimide end-groups graft to surface-adsorbed carbohydrates, presumably by a hydrogen abstraction mechanism followed by radical recombination to form a covalent bond. Immobilized carbohydrate thin films are evidenced by fluorescence, ellipsometry and contact- angle measurements. Surface micropatterns of mono-, oligo-, and polysaccharides are generated by exposure through a contact photomask and are visualized by condensing water onto the surface. The efficiency of covalent coupling is dependent on the thermodynamic state of the surface. The amount of surface-grafted carbohydrate is enhanced when carbohydrate surface interactions are increased by the incorporation of amine-terminated molecules into the monolayer. Glass substrates modified with mixed monolayers of this nature are used to construct carbohydrate microarrays by spotting the carbohydrates with a robot and subsequently illuminating them with UV light to covalently link the carbohydrates.Surface-immobilizedpolysaccharidesdisplaywell-definedantigenicdeterminantsforantibodyrecognition. We demonstrate, therefore, that this novel technology combines the ability to create carbohydrate microarrays using the current state-of-the-art technology of robotic microspotting and the ability to control the shape of immobilized carbohydrate patterns with a spatial resolution defined by the UV wavelength and a shape defined by a photomask. Introduction Carbohydrates, like nucleic acids and proteins, carry important biological information. The development of high-throughput technologies for generating DNA and protein microarrays has been vigorously explored and has contributed greatly to the fields of genomics and proteomics. A newer field that explores the information content of carbohydrates, called glycomics, has recently emerged and has been facilitated by the relatively recent development of carbohydrate microarrays.1-10 Already, carbo- hydrate microarrays have been used to investigate the SARS6 and HIV7 viruses. In addition, enzyme activity,3,11 glycome sequencing,2 and carbohydrate interactions with cells,12,13 antibodies,1 and proteins4,14 have been studied with carbohydrate microarrays.Immobilizingcarbohydratesonsurfaceshasbecome a major preliminary challenge in the area. Most current methods involve either a noncovalent immobilization that becomes less stable as the molecular weight (MW) decreases, or synthetic methods in which each carbohydrate to be spotted must first be chemically modified. To develop a simple and universal approach to carbohydrate microarray fabrication, it is very important to devise methods that allow for covalent immobilization of carbohydrates on a surface without prior chemical derivatization. Only a few methods have been reported that demonstrate this goal. Underivatized carbohydrates have been covalently attached to monolayers bearing phenylboronic acid groups,15 polysac- charide films bearing diazirine groups,16 and hydrazide-coated glass slides.17 Only the latter two methods were used to construct microarrays. Carbohydrates also contain important physical and chemical propertiesthatmayfindutilityinbiotechnologyandnoveldevices. Surface-immobilized carbohydrates are potential components in biological sensors,18 scaffolds for tissue engineering,19 templates forstudyingcellbehaviorinaconfinedspace,20 suprabiomolecular structures on surfaces,21 host-guest complexes on a surface, * Corresponding author. † Department of Chemistry, Columbia University. ‡ Stanford University School of Medicine. § Department of Chemical Engineering, Columbia University. (1) Wang, D.; Liu, S.; Trummer, B. J.; Deng, C.; Wang, A. Nat. Biotechnol. 2002, 20 (3), 275-281. (2) Fukui, S.; Feizi, T.; Galustian, C.; Lawson Alexander, M.; Chai, W. Nat. Biotechnol. 2002, 20 (10), 1011-1017. (3) Fazio, F.; Bryan, M. C.; Blixt, O.; Paulson, J. C.; Wong, C.-H. J. Am. Chem. Soc. 2002, 124 (48), 14397-14402. (4) Park, S.; Shin, I. Angew. Chem., Int. Ed. 2002, 41 (17), 3180-3182. (5) Willats, W. G. T.; Rasmussen, S. E.; Kristensen, T.; Mikkelsen, J. D.; Knox, J. P. Proteomics 2002, 2 (12), 1666-1671. (6) Wang, D.; Lu, J. Physiol. Genomics 2004, 18 (2), 245-248. (7) Adams, E. W.; Ratner, D. M.; Bokesch, H. R.; McMahon, J. B.; O’Keefe, B. R.; Seeberger, P. H. Chem. Biol. 2004, 11 (6), 875-881. (8) Blixt, O.; Head, S.; Mondala, T.; Scanlan, C.; Huflejt, M. E.; Alvarez, R.; Bryan, M. C.; Fazio, F.; Calarese, D.; Stevens, J.; Razi, N.; Stevens, D. J.; Skehel, J. J.; van Die, I.; Burton, D. R.; Wilson, I. A.; Cummings, R.; Bovin, N.; Wong, C.-H.; Paulson, J. C. Proc. Natl. Acad. Sci. U.S.A. 2004, 101 (49), 17033-17038. (9) Houseman, B. T.; Mrksich, M. Chem. Biol. 2002, 9 (4), 443-454. (10) Ko, K.-S.; Jaipuri, F. A.; Pohl, N. L. J. Am. Chem. Soc. 2005, 127 (38), 13162-13163. (11) Bryan, M. C.; Lee, L. V.; Wong, C.-H. Bioorg. Med. Chem. Lett. 2004, 14 (12), 3185-3188. (12) Nimrichter, L.; Gargir, A.; Gortler, M.; Altstock, R. T.; Shtevi, A.; Weisshaus, O.; Fire, E.; Dotan, N.; Schnaar, R. L. Glycobiology 2004, 14 (2), 197-203. (13) Disney, M. D.; Seeberger, P. H. Chem. Biol. 2004, 11 (12), 1701-1707. (14) Park, S.; Lee, M.-R.; Pyo, S.-J.; Shin, I. J. Am. Chem. Soc. 2004, 126 (15), 4812-4819. (15) Takahashi, S.; Anzai, J. Langmuir 2005, 21 (11), 5102-5107. (16) Angeloni, S.; Ridet, J. L.; Kusy, N.; Gao, H.; Crevoisier, F.; Guinchard, S.; Kochhar, S.; Sigrist, H.; Sprenger, N. Glycobiology 2005, 15 (1), 31-41. (17) Lee, M.-R.; Shin, I. Org. Lett. 2005, 7 (19), 4269-4272. (18) Jelinek, R.; Kolusheva, S. Chem. ReV. 2004, 104 (12), 5987-6015. (19) Yeong, W.-Y.; Chua, C.-K.; Leong, K.-F.; Chandrasekaran, M. Trends Biotechnol. 2004, 22 (12), 643-652. (20) Chen, C. S.; Mrksich, M.; Huang, S.; Whitesides, G. M.; Ingber, D. E. Science 1997, 276 (5317), 1425-1428. (21) Liu, G.-Y.; Amro, N. A. Proc. Natl. Acad. Sci. U.S.A. 2002, 99 (8), 5165-5170. 2899Langmuir 2006, 22, 2899-2905 10.1021/la0531042 CCC: $33.50 © 2006 American Chemical Society Published on Web 02/15/2006
  • 2. and three-dimensional biochips.22 It is desirable to have spatial control over surface immobilization when incorporating carbo- hydrates into many of these devices. One widely accessible approach involves pattern transfer via a photomask or stamp. Although patterning biological materials on surfaces using these versatile approaches has been demonstrated,23,24 there are relatively few reports focusing on carbohydrates.25 Irradiating photoactive surfaces in the presence of a photo- mask26 is a well-known technology that employs photons as traceless reagents for pattern formation without the use of a spotter, microstamps, or an atomic force microscope and has been used to control the spatial deposition of various materials including proteins,27 DNA,28 cells,29 and colloidal and nano- particles.30 The resolution of such patterns is controlled by the size of the illumination pattern and is not dependent on the size of the drop placed on the surface by a spotter. Such features allow greater control over the size and shape of a micron-sized architecture. As the size of such patterns continues to decrease, scaffolds of individual macromolecules could be produced, allowing for interactions at the single-molecule or few-molecules level to be interrogated. In addition, reducing the size of the pattern reduces the amount of material consumed. In this report, we demonstrate a versatile method for covalent immobilization and patterning of unmodified mono-, oligo-, and polysaccharides onto glass substrates. This technology involves self-assembly of a new class of photoactive monolayers onto glass substrates. The monolayers present phthalimide chromo- phores31 at the surface that, upon exposure to light, graft surface adsorbed carbohydrates by hydrogen abstraction followed by radical recombination. Using a robotic spotter, we are able to generate a microarray of carbohydrates and demonstrate high- throughput characterization of antigen-antibody interactions. The surface-immobilized carbohydrates retain their immunologi- calproperties.Incomparisonwithnitrocellulose-coatedsubstrates, an established technology for carbohydrate microarrays,1,2,6,32 this novel approach is much less dependent on the MW of the spotted carbohydrates and shows a higher grafting efficiency for lower MWs. The photochemical patterning method described herein requires no chemical modification of the sugars prior to deposition, is applicable for carbohydrates of different MWs, requires no chemical reagents for covalent coupling of carbo- hydrates on the surfaces, and uses existing microspotting devices for high-throughput microarray construction. The methodology we present has potential applications in materials, biological, and medical research. Results and Discussion To covalently link carbohydrates to a surface without prior derivatization, we created self-assembled monolayers (SAMs) containing aromatic carbonyls that can react with C-H groups upon absorption of a photon to form a covalent bond.33 Phthalimide derivatives can undergo all the major photochemical reactions of aromatic carbonyls.31 Exposure to UV light produces an excited n-π* state that can abstract a hydrogen atom from a nearby molecule. The resulting radicals can then recombine, forming a covalent bond as shown in Figure 1. Other secondary processes are also possible, including disproportionation and back-transfer.CarbohydratesubstratescanundergopH-dependent and independent rearrangements, depending on the structure of thecarbohydrate.34 Facileincorporationofpotassiumphthalimide into bromine-terminated silanes allows for self-assembly on silicon, glass, or quartz substrates. Terminal groups other than silanes could readily be employed in the synthesis to create phthalimides for self-assembly onto other substrates. To create a novel surface suitable for immobilizing carbo- hydrates, a phthalimide-derivatized silane was synthesized in one step by reacting 11-bromoundecanetrimethoxy silane with potassium phthalimide in dimethylformamide (DMF) to produce 11-phthalimidoundecanetrimethoxy silane (compound 1). Com- pound 1 was self-assembled on silicon, glass, and quartz in anhydrous toluene to produce SAM 1 as shown in Figure 2. The self-assembly of compound 1 on the surface was verified by UV/Visible (UV-vis) spectroscopy as shown in Figure 3. Under the rough assumption that the extinction coefficient of the chromophore on the surface is the same as that in solution, the approximate surface coverage was calculated to be 5.5 molecules/ nm2.35 A rough calculation using Chem.3D suggests that about 4.9 aliphatic phthalimides can fit in a space of 1 nm2, a value that is the same order of magnitude as the experimental value, suggesting that SAM 1 is densely packed. In addition, an H2O contact angle of 65 (1° and an ellipsometric thickness of 1.4 ( 0.1 nm indicated the self-assembly of compound 1 on silicon. To test the ability of surface-bound phthalimides to photo- chemically immobilize sugars, 2000 kDa fluorescein isothio- cyanate (FITC)-conjugated R(1,6)dextran polysaccharide films were spin-coated onto SAM 1 from an aqueous solution and irradiated for approximately 1 h with a 300 nm rayonet bulb in an inert environment. Two controls were also prepared. In the first, polysaccharides were spin-coated onto SAM 1 and left in the dark. In the second, polysaccharides were spin-coated onto an underivatized silicon wafer. All three samples were placed in water-filled vials for 12 h. After removing the samples and (22) Blawas, A. S.; Reichert, W. M. Biomaterials 1998, 19 (7-9), 595-609. (23) Whitesides, G. M.; Ostuni, E.; Takayama, S.; Jiang, X.; Ingber, D. E. Annu. ReV. Biomed. Eng. 2001, 3, 335-373. (24) Pirrung, M. C. Angew. Chem., Int. Ed. 2002, 41 (8), 1276-1289. (25) Chevolot, Y.; Bucher, O.; Leonard, D.; Mathieu, H. J.; Sigrist, H. Bioconjugate Chem. 1999, 10 (2), 169-175. (26) Fodor, S. P. A.; Read, J. L.; Pirrung, M. C.; Stryer, L.; Lu, A. T.; Solas, D. Science 1991, 251 (4995), 767-773. (27) Rozsnyai, L. F.; Fodor, S. P. A.; Schultz, P. G.; Benson, D. R. Angew. Chem. 1992, 104 (6), 801-802. (28) Pease, A. C.; Solas, D.; Sullivan, E. J.; Cronin, M. T.; Holmes, C. P.; Fodor, S. P. A. Proc. Natl. Acad. Sci. U.S.A. 1994, 91 (11), 5022-5026. (29) Dillmore, W. S.; Yousaf, M. N.; Mrksich, M. Langmuir 2004, 20 (17), 7223-7231. (30) Lee, K.; Pan, F.; Carroll, G. T.; Turro, N. J.; Koberstein, J. T. Langmuir 2004, 20 (5), 1812-1818. (31) Kanaoka, Y. Acc. Chem. Res. 1978, 11 (11), 407-413. (32) Wang, D. Proteomics 2003, 3 (11), 2167-2175. (33) Turro, N. J. Modern Molecular Photochemistry; University Science Books: Sausalito, CA, 1991. (34) Gilbert, B. C.; King, D. M.; Thomas, C. B. Carbohydr. Res. 1984, 125 (2), 217-235. (35) Moon, J. H.; Shin, J. W.; Kim, S. Y.; Park, J. W. Langmuir 1996, 12 (20), 4621-4624. Figure 1. Schematic of a phthalimide derivative undergoing a photochemical hydrogen abstraction reaction followed by recombination to form a covalent bond. 2900 Langmuir, Vol. 22, No. 6, 2006 Carroll et al.
  • 3. rinsing with water and methanol followed by blow-drying with argon, the fluorescence spectrum of each sample was obtained, as shown in Figure 4. Preferential retention of polysaccharides on the irradiated sample relative to the two controls indicates the photochemical immobilization of the polysaccharides on SAM 1. The film thicknesses of the three samples were measured using a Beaglehole ellipsometer in variable angle mode. A refractive index value of 1.5 was used for the organic layer. The irradiated sample retained 7.1 ( 0.3 nm of material after the rinse. The thickness of the material on SAM 1 unexposed to light was 0.7 ( 0.3 nm, and the thickness on the underivatized silicon wafer was 0.4 ( 0.3 nm. The reported thicknesses do not include the thickness of SAM 1. The surfaces were further investigated with water contact-angle measurements. The hydrophilic nature of the sugars reduced the water contact angle from 65 ( 1 to 28 ( 1° on the irradiated SAM. Inefficient immobilization on the dark control is evident from a post-rinse contact angle of 62 ( 1°. The higher retention of material on the irradiated SAM demonstrates that self-assembled phthalimide monolayers are capable of photochemically bonding to an overlayer sugar film, despite any spatial restrictions on the chromophore as a result of placement in a constrained environment. We speculate that the nature of the bonding is covalent and results from radical- radical recombination following hydrogen abstraction. The above experiments were also performed on SAMs comprised of benzophenone chromophores, another class of aromatic carbonyls that can photochemically abstract hydrogen from C-H groups and have been shown to graft polymers to surfaces.36 Although the benzophenone monolayers were able to graftthesugars,theresultingsugarfilmthicknessandfluorescence intensity were lower, and the contact angle was higher than that of the films on SAM 1. The lower performance may be due to the radical center in the benzophenone SAM residing further from the surface than that in the phthalimides, self-quenching of the excited state, or a higher interfacial tension between the more hydrophobic benzophenone monolayer and the sugar film compared to the phthalimide-sugar interaction. Benzophenone SAMs have more hydrophobic character than phthalimide SAMs, as evidenced by a higher water contact angle of about 85°. Preliminary experiments with a microarray spotter have shown thathydrophilicsurfacesaremoreeasilyspottedthanhydrophobic substrates. We found that more material physisorbed onto SAM 1 in comparison to a benzophenone-terminated SAM. In any case, other photoactive carbonyl groups capable of abstracting hydrogen atoms can be substituted and may enhance or retard the reaction because of the efficiency of self-assembly, steric, and thermodynamic constraints. In addition to covalently attaching underivatized sugars to a substrate, we are also able to generate patterns of grafted sugars. Our strategy for immobilizing carbohydrates on SAM 1 in a spatially controlled fashion is presented in Figure 5. Spin-coated polysaccharide films were covered with a photomask consisting of a copper grid with spacings of 280 µm and irradiated for 2 h as described above. The photoreaction is restricted to the opaque regions of the mask, leaving the pattern of the mask written to the surface via attached carbohydrates. We removed ungrafted sugars by sonicating films in water for 15 min, changing the water and vial every 5 min. (36) Prucker, O.; Naumann, C. A.; Ruehe, J.; Knoll, W.; Frank, C. W. J. Am. Chem. Soc. 1999, 121 (38), 8766-8770. Figure 2. Synthesis of compound 1 and SAM 1. Figure 3. UV/vis spectra of compound 1 in ethanol (dashed line) and SAM 1 (solid line). Figure 4. Fluorescence spectra of 2000 kDa FITC-conjugated R- (1,6)dextran films under three conditions: irradiated SAM 1 (dashed line), dark SAM 1 (dotted line), and underivatized silicon (solid line). Each spectrum was obtained after washing the substrates for 12 h in H2O. Photochemical Micropatterning of Carbohydrates Langmuir, Vol. 22, No. 6, 2006 2901
  • 4. Condensing water onto the substrate provided a quick way to visualize the hydrophilic patterns using optical microscopy.37 Figure 6 presents an optical microscope image of water condensation onto patterned R(1,6)dextran polysaccharides with a MW of 2000 kDa. The hydrophilic attraction between water andthepolysaccharidesrelativetotheunmodifiedmaskedregions of the monolayer causes water to preferentially reside on the areas of the substrate containing polysaccharide. The results were similar when 20 kDa R(1,6)dextrans were patterned. Other strategies involving immobilization without prior derivatization have been successful with carbohydrate-containing macromolecules noncovalently adsorbed on nitrocellulose1 or oxidized polystyrene (PS);5 however, the nitrocellulose study showed that the immobilization efficiency decreases with the MW of the polysaccharides.1 To show the versatility of our method, we tested glucose and sucrosestwo simple sugars at the low extreme of MW, containing both six- and five-membered sugar moieties. The resulting water condensation images are presented in Figure 7. The visible patterns clearly show that our method extends to sugars of the lowest MWs. To show that our method is applicable for the high-throughput production of carbohydrate microarrays, we investigated whether carbohydrates could be microspotted and subsequently photo- immobilized using a robotic spotter. We applied the FITC- conjugated polysaccharides as probes to monitor the spotting (37) Lopez, G. P.; Biebuyck, H. A.; Frisbie, C. D.; Whitesides, G. M. Science 1993, 260 (5108), 647-649. Figure 5. The strategy for direct chemical patterning of a surface with carbohydrates involves a photolithographic technique. Carbohydrates are spin-coated onto SAM 1 and covered with a mask. Irradiation induces a photochemical reaction that covalently links the carbohydrates to SAM 1. Figure 6. Optical microscope images of water condensation on photochemically generated patterns of polysaccharides on SAM 1. Figure 7. Optical microscope images of breath condensation on photochemically generated patterns of (a) sucrose and (b) glucose. 2902 Langmuir, Vol. 22, No. 6, 2006 Carroll et al.
  • 5. process. After irradiation for 1 h, extensive washing, and “blocking” with bovine serum albumin (BSA), we introduced specific antibodies and lectins to detect immobilized carbohy- drates. Bound antibodies were revealed with a streptavidin-Cy3 conjugate. We found that the thermodynamic parameters of the surface needed to be adjusted to transfer a detectable amount of carbohydrates from the pin of the spotter to SAM 1. To make the surface more attractive to carbohydrates, we made mixed phthalimide-amine monolayers (PAM) from a solution contain- ing a 5:1 ratio of aminopropyltrimethoxy silane to compound 1. Presumably,thehydrophilicaminegroupinteractsmorefavorably with the carbohydrates compared to the more hydrophobic phenyl ring of compound 1, decreasing the interfacial tension between the carbohydrate and the substrate, which allows a sufficient amount of carbohydrates to be adsorbed to the surface for subsequent photoimmobilization. Figure 8a,b presents the results after spotting FITC-conjugated R(1,6)dextrans with MWs of 20, 70, and 2000 kDa on PAM and nitrocellulose-coated FAST slides. The FAST slide was treated to provide a comparison of our new method with an established platform. By examining the fluorescent signals of the spotted slides before irradiation and washing (Figure 8a), we found that theamountsofcarbohydratesadsorbedontoPAMaresignificantly less than those spotted on the FAST slide. This may be attributed to the two-dimensional nature of PAM, which allows less polysaccharides to be delivered and adsorbed in comparison to nitrocellulose surfaces with thicker three-dimensional coatings. However, staining the slides with an anti-R(1,6)dextran antibody (16.4.12E), which is specific for the terminal nonreducing end epitopes displayed by all three dextran conjugates1 revealed that the PAM surface retains a similar amount of polysaccharides regardless of the MW of the polysaccharides spotted (Figure 8b). Neither an underivatized glass substrate nor PAM without UVirradiationshowedadetectablesignalwithanti-R(1,6)dextran antibodies under the same experimental conditions. These results were reproduced in multiple microarray assays (data not shown). Thus, not only is PAM suitable for use in the high-throughput construction of polysaccharide microarrays, but the photoim- mobilized carbohydrates also retain their immunological proper- ties, as defined by a specific antibody, after immobilization. We further examined a panel of mono- and oligosaccharide arrays on PAM and FAST slides. The spotted arrays were probed with a biotinylated lectin, Concanavalin A (Con A; Figure 8c), which is Man- and/or Glc-specific and requires the C-3, C-4, and C-5 hydroxyl groups of the Man or Glc ring for binding. We found that oligosaccharides with three (IM3), five (IM5), and seven glucoses (IM7) are reactive to Con A on the PAM slide but not on the FAST slide. However, none of the spotted monosaccharides were reactive to the lectin on these surfaces. The method of photocoupling, which can target any CH- group on the sugar rings with varying specificity depending on the structure of the ring34,38,39 (Figure 5), may interfere significantly with the lectin binding of monosaccharides, Man, or Glc. The limited specificity of the reaction and the lesser amount of saccharide epitopes present for smaller carbohydrates reduces (38) Madden, K. P.; Fessenden, R. W. J. Am. Chem. Soc. 1982, 104 (9), 2578- 2581. (39) Shkrob, I. A.; Depew, M. C.; Wan, J. K. S. Chem. Phys. Lett. 1993, 202 (1-2), 133-140. Figure 8. Immobilization of mono-, oligo-, and polysaccharides on PAM. A FAST slide is included for comparison. (A) Fluorescence images and intensity values of the spotted polysaccharides, the FITC-conjugated R(1,6)dextrans of 20-, 70-, and 2000 kD, before treatment with light. The three-dimensional FAST slide adsorbs more material than does the two-dimensional PAM. (B) Fluorescence images and intensity values after treatment with light, rinsing, and staining with a biotinylated anti-dextran antibody (16.4.12E), followed by staining with a Streptavidin-Cy3 conjugate. Immobilization on PAM is not dependent on MW, and a greater amount of 20 kD polysaccharides are retained even though much less material could initially be spotted. (C) Fluorescence intensity values of mono- and oligosaccharide arrays after treatment with light, rinsing, and staining with a biotinylated lectin, Con A, followed by staining with a Streptavidin-Cy5 conjugate. IM3, IM5, and IM7 refer to isomaltotriose, isomaltopentose, and isomaltoheptaose, respectively. Photochemical Micropatterning of Carbohydrates Langmuir, Vol. 22, No. 6, 2006 2903
  • 6. the probability that a biologically active epitope presents itself at the air-monolayer interface. These results show that PAM offers a plausible alternative to nitrocellulosefordisplayingpolysaccharidesandoligosaccharides on glass chips. Larger panels of carbohydrates with structural and immunological diversities must be introduced to further validate and explore the potential of this novel chip substrate for microarray technologies. Althoughthisreportfocusesontheapplicationofimmobilizing andpatterningcarbohydrates,phthalimide-containingmonolayers are suitable for patterning virtually any material containing C-H groups. In addition to various carbohydrates, we are also able to pattern a variety of polymers. PS, poly(methyl methacrylate) (PMMA), and poly(vinyl alcohol) (PVA) were all immobilized and patterned on SAM 1 (see Supporting Information for images). Theversatilityofourmethodallowsmaterialswithvaryingsurface tensions and chemical functionalities to be immobilized and patterned on a surface, allowing for a fast and simple approach to design organic scaffolds for novel materials and devices. Summary We have shown that a new class of SAMs containing phthalimide chromophores is capable of photochemically im- mobilizing carbohydrates on a flat substrate. The method requires no chemical modification of the carbohydrates prior to deposition and is not limited to carbohydrates of high MWs. Further, immobilizedcarbohydrateantigensareshowntoretaintheirability to interact with the corresponding antibody or lectin. The photochemicalnatureofthetechniqueallowspatternstobecreated and makes the method adaptable to the full potential of photolithography, which is currently used in industry for the high-throughput fabrication of computer chips and nanoscale patterning. Multiple carbohydrate patterns can be immobilized by repeating the reaction with a different carbohydrate in a previously masked region. In conjunction with a microarray spotter, large libraries of carbohydrates can be immobilized on our surface without previous derivatization. The versatility and ease of the method provides a platform for biologists, chemists, and engineers to investigate and create new biological materials aswellascharacterizecarbohydrateinteractionsinarapidmanner. Methods Synthesis of Compound 1. A 3.3 mmol portion of 11- bromoundecanetrimethoxysilane (Gelest) was added to a solution of an equimolar amount of potassium phthalimide (Aldrich) in 60 mL of anhydrous DMF (Aldrich). The solution was stirred overnight at room temperature (RT) under argon. Chloroform (50 mL) was added. The solution was transferred to a separatory flask containing 50 mL of H2O. The aqueous layer was separated and then extracted with two 20 mL portions of chloroform. The combined chloroform extract was washed with several 20 mL portions of H2O. The chloroform was removed by rotoevaporation, and residual DMF was removed on a high vacuum line to give a pale yellow liquid (0.99 g, 72% yield). The compound was used without further purification. Note that, for self-assembly experiments, residual DMF was not removed. 1H NMR: (CDCl3) δ 7.82 (m, 2H), 7.69 (m, 2H), 3.66 (t, J ) 7 Hz, 2H), 3.55 (s, 9H), 1.44-1.15 (m, 18H), 0.71-0.51 (m, 2H). LRMS-FAB+ (m/z): (M - H) 420.2 (experimental), 420.2 (calculated); (M - OCH3) 390.1 (experimental), 390.2 (calculated). Self-Assembly of SAM 1. The substrates consisted of glass (ArrayIt), quartz (SPI), or silicon (wafer world). The substrates and glassware were cleaned by being boiled in a “piranha” solution (7:3 sulfuric acid/H2O2) for 1 h followed by an extensive rinse with water and methanol. Substrates were dried with a stream of argon and immersed in a 1 mmol solution of compound 1 in anhydrous toluene (Aldrich). The solution was kept under argon and left undisturbed for 12 h. The resulting SAMs were rinsed with toluene and sonicated three times for 2 min each in toluene, toluene/methanol (1:1), and methanol. Substrates were kept in argon-purged vials until further use. Preparation of PAM. PAM was made in the same manner as SAM 1, except that a 5× molar amount of aminopropyltrimethoxy silane (Gelest) was simultaneously added with compound 1. The contact angle of the resulting surface was 72 ( 1°. Photochemical Grafting of Polysaccharide Films. FITC- conjugated R(1,6)dextrans weighing 20 or 2000 kD (Dextran-FITC) (Sigma) were spin-coated from a 10 mg/mL aqueous solution at 3000rpmfor90sandplacedinargon-purgedquartztubes.Irradiation was carried out for 70 min with a Rayonet photochemical reactor equipped with lamps that emit at 300 nm. For ellipsometry and fluorescence experiments, the surface was rinsed by placing in H2O for 12 h followed by rinsing with methanol. Substrates were blown dry with argon. Instrumental Measurements. UV-vis spectra were obtained using a Shimadzu (UV-2401PC) UV-vis recording spectropho- tometer. Contact-angle measurements were performed with a Rame- Hart 100-00 contact-angle goniometer using Millipore Milli-Q water. At least three droplets were measured on each sample and averaged. ThicknessesweremeasuredwithaBeagleholeellipsometerinvariable angle mode. A refractive index of 1.5 was used for all samples. Measurements were performed three times in different locations on the surface and averaged. Fluorescence spectra were obtained using a Jobin Yvon Fluorolog 3 spectrofluorometer in front face mode. The surface was placed at an angle of 20° to a line parallel to the plane of the detector. Photochemical Patterning of Carbohydrates. A 75-mesh transmission electron microscopy (TEM) grid (Electron Microscopy) was used as a photomask for all patterning experiments. Dextran- FITC (2000 kD) and 20 kD polysaccharide films were prepared as described above. Glucose (Aldrich) was spin-coated from a solution of 26 mg in 1 mL of acetonitrile at 3000 rpm for 90 s. One drop of a sucrose (Aldrich) solution containing 1.5 g in 1 mL H2O was placed on the substrate using a pipet. Approximately three-fourths of the drop was removed with a pipet. In all cases, the photomask was placed on top of the sugar film or droplet and pressed down with a quartz plate. Irradiation was carried out in an argon-filled glovebag with a desktop lamp containing a 300 nm Rayonet bulb for approximately 2 h. Samples were rinsed by sonication in H2O for 15min,withthewaterandvialbeingchangedevery5min.Sonication was accompanied by extensive rinsing with water and methanol. Samples were blown dry with argon. Visualization of the Chemically Patterned Surface. Patterns were visualized by condensing water onto the pattern and imaging with a Nikon Eclipse optical microscope equipped with an INSIGHT digital camera. Two methods were used to condense water onto the surface. In the first, the surface was exposed to an extended breath. In the second, the substrate was held over boiling water for approximately 10 s. Microarray Construction. Antigen preparations were dissolved in saline (0.9% NaCl) at a given concentration and were spotted as triplet replicate spots in parallel. The initial amount of antigen spotted was approximately 0.35 ng/spot and was diluted by serial dilutions of 1:5 thereafter (see also the microarray images inserted in Figure 8). A high-precision robot designed to produce cDNA microarrays (PIXSYS 5500C, Cartesian Technologies, Irvine, CA) was utilized to spot carbohydrate antigens onto chemically modified glass slides as described.1,6 Both FAST slides (Schleicher & Schuell, Keene, NH) and PAM slides were spotted. The printed FAST slides were air-dried and stored at RT. The printed PAM slides were subjected to UV irradiation to activate the photocoupling of carbohydrates to the surface. PhotocouplingofCarbohydratesontheChips.Aftermicroarray spotting, the PAM slides were air-dried and placed in a quartz tube. The sealed tube was subsequently purged with argon or nitrogen before irradiation. UV irradiation was conducted by placing the quartz tube under a desktop lamp containing a 300 nm Rayonet bulb 2904 Langmuir, Vol. 22, No. 6, 2006 Carroll et al.
  • 7. for 1 h. Precaution was made to avoid skin and eye contact with the radiation during the irradiation process. Microarray Staining, Scanning, and Data-Processing. Im- mediately beforeuse,theprintedmicroarrayswererinsedandwashed withphosphate-bufferedsaline(PBS)(pH7.4)andwith0.05%Tween 20 five times, with 5 min of incubation in each washing step. They were then “blocked” by incubating the slides in 1% BSA in PBS containing 0.05% NaN3 at RT for 30 min. Antibody staining was conducted at RT for 1 h at given dilutions in 1% BSA/PBS containing 0.05% NaN3 and 0.05% Tween 20. Since a biotinylated anti-dextran antibody (mAb 16. 4.12E, adapted from the late Professor Elvin A. Kabat at Columbia University) and lectin Con A (EY Laboratories, San Mateo, CA) were applied in this study, streptavidin-Cy3 conjugateorstreptavidin-Cy5conjugate(AmershamPharmasia)were applied to reveal the bound anti-dextran antibodies or lectin Con A, respectively. The stained slides were rinsed five times with PBS and with 0.05% Tween 20 after each staining step. A ScanArray 5000A standard biochip scanning system (Perkin Elmer, Torrance, CA), equipped with multiple lasers, emission filters, and ScanArray acquisition software, was used to scan the microarray. Fluorescence intensityvaluesforeacharrayspotanditsbackgroundwerecalculated using ScanArray Express (Perkin Elmer, Torrance, CA). Acknowledgment. This material is based upon work sup- ported by, or in part by, the U.S. Army Research Laboratory and the U.S. Army Research Office under Contract/Grant No. DA W911NF-04-1-0282, the National Science Foundation under Grant Nos. DMR-02-14263, IGERT-02-21589, and CHE-04- 15516 to N.J.T. and J.T.K. at Columbia University, and the Phil N. Allen Trust and the Herzenberg Trust to D.W. at Stanford University. This work used the shared experimental facilities that are supported primarily by the MRSEC Program of the National Science Foundation under Award No. DMR-0213574 and the New York State Office of Science, Technology and AcademicResearch(NYSTAR).G.T.C.acknowledgesanIGERT fellowship. Any opinions, findings, and conclusions or recom- mendations expressed in this material are those of the author(s) and do not necessarily reflect the views of the National Science Foundation. SupportingInformationAvailable: Optical microscope images of patterns of PVA, poly(tert-butyl acrylate) (PTBA), and PS. This material is available free of charge via the Internet at http://pubs.acs.org. LA0531042 Photochemical Micropatterning of Carbohydrates Langmuir, Vol. 22, No. 6, 2006 2905